(data stored in ACNUC30630 zone)

EMBL: CP001737.PE223

CP001737.PE223       Location/Qualifiers
FT   CDS_pept        complement(259571..259918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0230"
FT                   /product="protein of unknown function DUF1025"
FT                   /note="PFAM: protein of unknown function DUF1025; KEGG:
FT                   avi:Avi_4376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76661"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJX8"
FT                   /inference="protein motif:PFAM:PF06262"
FT                   /protein_id="ACV76661.1"
FT                   /translation="MAVQMSMDAFEDLVAEALDLIPPEFTRAMDNVVVLVEDRHPTQNL
FT                   YGLYHGVALTSRTSSYSGHLPDTITIYRLPILAHAHDEQQAREQVATTVIHEIAHHFGI
FT                   DDDRLDELGWA"
     gtggccgtac agatgtcgat ggacgcgttc gaggacctgg tcgccgaggc cctcgacctg        60
     atcccgccgg agttcacccg ggcgatggac aacgtggtcg tcctggtcga ggatcgtcat       120
     cccacccaga acctctacgg gctctaccac ggggtcgccc tgacctcgcg gacgtcgagc       180
     tactccgggc atctgcccga caccattacc atctaccggc tgccgatcct ggctcacgcc       240
     cacgacgagc agcaggcccg cgagcaggtg gcgaccaccg tcatccacga gatcgcccac       300
     cacttcggca tcgacgacga ccggctcgac gaactgggct gggcctga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page