(data stored in ACNUC30630 zone)

EMBL: CP001737.PE230

CP001737.PE230       Location/Qualifiers
FT   CDS_pept        266987..267328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0237"
FT                   /product="hydroxyisourate hydrolase"
FT                   /note="TIGRFAM: hydroxyisourate hydrolase; PFAM:
FT                   Transthyretin; KEGG: sew:SeSA_A1161 hydroxyisourate
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76668"
FT                   /db_xref="GOA:C8XJY5"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJY5"
FT                   /inference="protein motif:TFAM:TIGR02962"
FT                   /protein_id="ACV76668.1"
FT                   /translation="MTIVRLSTHVLDTTVGRPAGGIPANLESLTPEGVSEVGRGRTDDD
FT                   GRVFQLNATGLAPGRYRLTLETEDYFRARHGAVFYPSIAVSFELSGDRDHYHIAVLTST
FT                   YSYSTYLGS"
     atgaccatcg tccggctcag cactcacgtc ctggacacga ccgtcggccg gcccgccggt        60
     ggcatccccg ccaacctgga aagcctgact ccggaaggtg tatcggaggt gggccggggc       120
     cgcaccgacg atgacgggcg ggtcttccag ctcaacgcga ccggcctggc cccgggccgg       180
     taccggctca ccctggagac cgaggactac ttccgggcgc gtcatggagc ggtgttctac       240
     ccgtccatcg ccgtctcgtt cgagctgtcc ggcgaccggg atcattacca cattgccgtg       300
     ctgaccagca cgtattcgta ctccacctat ctgggcagct ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page