(data stored in ACNUC30630 zone)

EMBL: CP001737.PE233

CP001737.PE233       Location/Qualifiers
FT   CDS_pept        complement(268707..269126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0240"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: mlo:mll4282 organic
FT                   hydroperoxide resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76671"
FT                   /db_xref="GOA:C8XJY8"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJY8"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACV76671.1"
FT                   /translation="MTVVYQTTATSTGEGRNGRSRTDDGVLDLALTTPRPGAGPGDPTN
FT                   PEQLFAAGYAACFHSALKNLAKAAGVDATDSSVSVQIGLVKGEDGFHLAAAITGELPRA
FT                   DRAAAADLLEQAHQRCPYSKAIRGNVEVTLSVRDA"
     atgaccgtcg tctaccagac gaccgccacc tccaccggag aaggccgcaa cggccgttcc        60
     cgcaccgacg acggtgtgct ggacctggcc ttgaccacgc cgcggccggg cgccggcccc       120
     ggtgatccca ccaaccccga gcagctgttc gcggccgggt acgcggcctg cttccactcc       180
     gcgctcaaga acctggccaa ggcggccggg gtggacgcca ccgattcgtc ggtcagcgtg       240
     cagatcggcc tggtcaaggg cgaggacggc ttccacctgg cggccgcgat caccggggaa       300
     ctgccccggg ccgaccgcgc cgccgcggcc gacctgctgg agcaggccca tcagcgctgc       360
     ccgtactcca aggcgatccg cggcaacgtc gaggtcaccc tgtcggtccg ggacgcctga       420
//

If you have problems or comments...

PBIL Back to PBIL home page