(data stored in ACNUC30630 zone)

EMBL: CP001737.PE240

CP001737.PE240       Location/Qualifiers
FT   CDS_pept        complement(277914..279536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0248"
FT                   /product="malate synthase A"
FT                   /EC_number="2.3.3.9"
FT                   /note="KEGG: scl:sce8725 malate synthase; TIGRFAM: malate
FT                   synthase A; PFAM: malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76678"
FT                   /db_xref="GOA:C8XJZ5"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR019830"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJZ5"
FT                   /inference="protein motif:TFAM:TIGR01344"
FT                   /protein_id="ACV76678.1"
FT                   /translation="MGVTLNGPEIARADEILTPDAVAFVADLHRRFAGRRDELLAERTR
FT                   RRERAARSGRLDVRPETAGIRAADWTVAAAPADLVDRRVEITGPPEPKMAINALNSGAR
FT                   VWLADLEDANTPHWRNVVGGQLVLFDAIRGTLAFDSPDGRPYRLATDRRLATIVARPRG
FT                   WHFDERHLLVDGEPAVGALVDFGLYFFHNAAELLARGSGPYFYLPKMESHLEARLWNDV
FT                   FTHAQAELGIAHGTIRATVLIETIPAAFEMDEILYELREHASGLNAGRWDYLFSVIKYF
FT                   RDAGPTFVLPDRGSVTMTAPMMRAYTDLLVATCHRRGAFAMGGMAAFIPSRRDPEVNRA
FT                   ALAKVRADKEREAGDGFDGSWVAHPDLVPVCAEVFDAVLGDRPNQLDRRRDDVQVTADQ
FT                   LLDVTSVPGSITEAGLRGNIDVALRYLEAWLGGNGAVGIHNLMEDAATAEISRSQVWQW
FT                   VHHGVQLDTGLTVTAELVCRIADEELAAIAAELGSQTYAASQYPLARSVFEQVALADEF
FT                   ADFLTLPAYAAAHDAELAASRQA"
     atgggcgtca cgctcaacgg acccgagatc gcccgcgccg acgagattct cactccggac        60
     gcggtggcct tcgtggccga tctgcatcgc cgtttcgccg gccggcggga cgagctgctg       120
     gccgagcgca cccgccgtcg cgagcgggcc gcccgctccg gccggctgga cgtccggccg       180
     gagaccgcgg gcatccgggc cgccgactgg accgtcgcgg ccgccccggc cgacctggtc       240
     gaccgccggg tggagatcac cggcccgccc gagccgaaga tggccatcaa cgccctgaac       300
     tcgggagcgc gggtatggct ggccgacctg gaggacgcga acaccccgca ctggcgcaac       360
     gtggtcggtg ggcagctggt gctcttcgac gccatccgcg gcaccctggc cttcgattcc       420
     ccggacggcc ggccctaccg gctggccacc gaccggcggc tggccaccat cgtcgcccgg       480
     ccgcggggtt ggcacttcga cgagcgacac ctgctggtgg acggcgagcc cgccgtcggt       540
     gccctggtcg acttcgggct ctacttcttc cacaacgcgg ccgaactgct ggcccggggc       600
     agcggaccgt acttctacct gccgaagatg gagagccatc tggaggcgcg gctgtggaac       660
     gacgtgttca ctcacgccca ggccgaactg ggcatcgccc acggcaccat ccgggccacc       720
     gtgctgatcg agaccatccc ggccgcgttc gagatggacg agattctcta tgagctgcgc       780
     gagcacgcgt ccggcctgaa tgccggccgc tgggactacc tgttcagcgt catcaagtac       840
     ttccgtgatg ccggccccac gttcgtgctg cccgatcggg gcagcgtgac catgaccgcc       900
     ccgatgatgc gcgcctacac cgacctgctg gtggcgacct gccaccgccg cggggcgttc       960
     gcgatgggcg gcatggccgc cttcatcccg agccggcggg accccgaggt caaccgggcc      1020
     gccctggcca aggtgcgggc ggacaaggaa cgggaggccg gcgacggctt cgacggctcc      1080
     tgggtggccc acccggacct ggtcccggtg tgtgccgagg tgttcgacgc cgtgctcggc      1140
     gaccggccca accagctcga ccgccgccgg gacgacgtcc aggtcacggc cgatcagcta      1200
     ctggacgtga cctccgtgcc gggctcgatc accgaagccg ggctgcgcgg caacatcgac      1260
     gtggccctgc gctacctgga ggcctggctc ggcggcaacg gcgccgtcgg catccacaac      1320
     ctgatggagg atgcggccac cgcggagatc tcccggtccc aggtgtggca gtgggtgcat      1380
     cacggtgtgc agctggacac cgggctgacc gtcaccgcgg agctggtctg ccggatcgcc      1440
     gacgaggaac tggccgcgat cgccgccgag ctgggctcgc agacctacgc ggcaagccag      1500
     tacccgttgg cccgcagcgt cttcgagcag gtggccctgg ccgacgagtt cgccgatttc      1560
     ctcaccctgc cggcctacgc ggcggcccat gatgcggagt tggcggccag ccgtcaggct      1620
     tga                                                                    1623
//

If you have problems or comments...

PBIL Back to PBIL home page