(data stored in ACNUC30630 zone)

EMBL: CP001737.PE241

CP001737.PE241       Location/Qualifiers
FT   CDS_pept        complement(279536..280999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0249"
FT                   /product="xanthine permease"
FT                   /note="TIGRFAM: xanthine permease; uracil-xanthine
FT                   permease; PFAM: Xanthine/uracil/vitamin C permease;
FT                   Benzoate membrane transport protein; KEGG: ppu:PP_4643
FT                   xanthine/uracil permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76679"
FT                   /db_xref="GOA:C8XJZ6"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJZ6"
FT                   /inference="protein motif:TFAM:TIGR03173"
FT                   /protein_id="ACV76679.1"
FT                   /translation="MAHQPESFAGQQGVELLPDGKHPVDEVLKPGPMILFGLQHVMSMY
FT                   AGVVAVPFIVGSALGLSFADLSYLLAATLLVSGLATLLQTLGVKWIGAKLPIVQGTSFA
FT                   AVASMIAVGASAGGGVDGLRAIFGSVLIAGLAGFLLSGVFARLLRFFPPVVTGSIITVI
FT                   GISLLPVAMRWAGGGAGSADFGSISNITLAAITLGIILVIYRFLPGFFSRIAIIAGLVA
FT                   GGVVAALMGKLDFSKVGQAQAFAISTPFHFGTPTFQVAAIISMVIVMLVIMTETTADLL
FT                   AIGVVVGREADRKTVANGLRADCISTAASGGLLNGFPVSAFAQNVGLVALTGIRSRFVV
FT                   AVSGGILLVLGLFPQVGAVVAALPLPVLGGAGLALFGTVAASGIRSLAAVKYDGNSNLV
FT                   IVALAIAAGLTPIAVPEFYHSFPEWFQTIFDSGISASAVTAVTLNIFFNVLGRKDDAAP
FT                   IFAESPAIGVSPDEQPGGHLPGDPRKGSH"
     atggcccacc aacccgaatc attcgcgggg cagcagggcg tcgaactgct gcccgacggg        60
     aagcatcccg tcgacgaggt gctcaagccg ggaccgatga tcctgttcgg cctgcagcac       120
     gtgatgagca tgtatgccgg cgtggtcgcg gtgccgttca tcgtcggctc cgcgctgggc       180
     ctgtccttcg ccgatctgtc ctacctgctg gccgccacct tgctggtctc cggcctggcc       240
     actctgctgc agaccctggg cgtgaagtgg atcggcgcca aactgccgat cgtgcagggc       300
     acgtcgttcg ccgcggtcgc ctccatgatt gccgtggggg cgtccgccgg cggcggggtc       360
     gacggcctac gggcgatctt cggctccgtc ctgatcgccg ggctggccgg gttcctgctg       420
     tccggggtgt tcgcccggtt gctgcgcttc ttcccgccgg tggtgaccgg gtcaatcatc       480
     acggtgatcg gcatctcgct gctgccggtg gccatgcgct gggccggcgg cggggccgga       540
     tcggccgact tcggctcgat ttccaacatc acgctggccg cgatcaccct gggcatcatc       600
     ctggtgatct accggttcct gcccggtttc ttctcccgga tcgcgatcat cgccggcctc       660
     gtcgccggcg gggtggtcgc cgccctgatg ggcaagctgg acttctccaa ggtgggtcag       720
     gctcaggcct tcgccatctc caccccgttc cacttcggca cgccgacctt ccaggtcgcg       780
     gccatcatct cgatggtcat cgtgatgctg gtgatcatga ccgagaccac ggcggacctg       840
     ctggccatcg gcgtggtcgt cggccgggag gccgaccgca agaccgtggc caacggcctg       900
     cgggccgact gcatctcgac cgcggcctcg ggcgggctgc tcaacggctt cccggtgagc       960
     gccttcgccc agaacgtcgg cctggtcgcg ttgaccggca tccgcagccg gttcgtggtg      1020
     gccgtcagcg gcggcatcct gctggtgctc gggctgttcc cccaggtggg cgcggtcgtc      1080
     gcggcgctgc cgctgcccgt gctcggtggg gccggcctgg ccctgttcgg cacggtcgcg      1140
     gccagcggca tccgcagcct ggcggcggtg aagtacgacg ggaactccaa cctggtcatc      1200
     gtcgcgctgg ccatcgccgc cggcctgacg ccgatcgccg tgcccgagtt ctaccactcg      1260
     ttcccggaat ggttccagac gatcttcgac tccggcatca gcgcctccgc ggtcaccgcc      1320
     gtcaccctga acatcttctt caacgtgctg ggccgcaagg acgacgcagc acccatcttc      1380
     gccgagtccc cggccatcgg ggtcagcccg gacgagcaac cgggcgggca cctgcccggc      1440
     gaccccagaa agggcagcca ctga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page