(data stored in ACNUC30630 zone)

EMBL: CP001737.PE245

CP001737.PE245       Location/Qualifiers
FT   CDS_pept        282965..283747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0253"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein; Ion transport
FT                   protein; KEGG: vcj:VCD_000055 possible potassium channel
FT                   VIC family"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76683"
FT                   /db_xref="GOA:C8XK00"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK00"
FT                   /inference="protein motif:PFAM:PF07885"
FT                   /protein_id="ACV76683.1"
FT                   /translation="MGTSDLDVQTPAFQAWTRAMEWPLMAVAVLFGVVYAYQVLAEPQG
FT                   ALLLATRVVSLLCWLVFAIDYVVRLWLATNRRRWFVRNILSLLVVTLPMLRPLRLVRLL
FT                   TLFTVFQRAAGTALRGRVVTYAAVTTTLLVFVASLAVFDAERYAPGALITTYGEAVWWA
FT                   CVTITTVGYGDAYPVTMEGRCIAVGMMICGIALVGTVTATIASWLVERVTSEEEAGQAA
FT                   TTAHIQLLADKIDRLEGLLSQAAADGQPRGTSRGEIVT"
     atggggacga gcgacctcga tgtccagacg ccggccttcc aggcctggac ccgcgcgatg        60
     gaatggccgc tgatggccgt ggccgtgctg ttcggcgtcg tctacgccta ccaggtgctg       120
     gccgagccgc agggggcgct gctgctggcc acccgggtgg tcagcctgct gtgctggctg       180
     gtcttcgcca tcgactacgt cgtccggctc tggctggcca ccaaccggcg ccgctggttc       240
     gtccgcaaca tcctgtcgct gctggtggtg accctgccga tgctgcgtcc gctgcggctg       300
     gtccggctgc tcaccctgtt cacggtgttc cagcgggccg ccggcaccgc cctgcgcggg       360
     cgggtggtga cctatgcggc cgtcaccacg acgctgctgg tcttcgtggc ctcgctggcg       420
     gtcttcgacg ccgagcgcta cgccccgggc gcgttgatca ccacctacgg cgaggcggtc       480
     tggtgggcct gcgtcaccat caccaccgtc ggctacggcg atgcctaccc ggtgacgatg       540
     gagggccgct gcatcgccgt cggcatgatg atctgcggga tcgccctggt cggcacggtg       600
     accgcgacga tcgcgtcgtg gttggtcgag cgggtcacca gcgaggagga ggccgggcag       660
     gcggccacca ccgcccacat ccagctgctg gccgacaaga tcgaccggct ggagggcctg       720
     ctgtcccagg ccgccgccga cggtcagccg cgcggtacct cacgcggtga gatcgtcacg       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page