(data stored in ACNUC30630 zone)

EMBL: CP001737.PE252

CP001737.PE252       Location/Qualifiers
FT   CDS_pept        complement(291570..292931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0260"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   ppg:PputGB1_3262 hydroxydechloroatrazine
FT                   ethylaminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76690"
FT                   /db_xref="GOA:C8XK07"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK07"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ACV76690.1"
FT                   /translation="MTTLVLQGAHVATVDGSATEYRNGHVVVTDGLITAVGNGPAVPGA
FT                   ADARILDATGCLITPGFVNTHHHLYQWITRGLAVDDTLFGWLTTLYPVWGQIDAELVNV
FT                   AATGGLSWLAGTGCTTTTDHHYVFPRDGGDVLKAEIDAAARVGLRFHPTRGSMDLGRSK
FT                   GGLPPDNVVEDIDAILAATEEAIDTHHDPSFGSMLRIGVAPCSPFSVTGDLLRQTAELS
FT                   RRKGVRMHTHLCETLDEEQYCQEHFGCSPVEYMESVGWLGPEVWLAHSVWLTDDSIASL
FT                   ARTGTSVAHCPTSNARLGSGIARARDLRDAGVAVGLGVDGAASNEACALLEEARHALLF
FT                   ARAKGGPQALTVRDALDMATMGGARVLGRQDEIGSLEVGKLADIAVWRLDTLPHIDIVD
FT                   PIAALVLGAPPPLELLLVGGRPIVEQGRLSTVDTDRYATEVRDASKKLLARAGI"
     atgacaaccc ttgtgctgca aggcgcccat gtcgccacgg tcgacggctc ggccaccgag        60
     taccgcaacg gccacgtcgt cgtcaccgac ggtctgatca ccgccgtcgg caacgggccg       120
     gcagtaccgg gagcggccga cgcccgcatt ctcgacgcga ccggctgcct gatcactccc       180
     gggttcgtga acacgcacca ccacctgtat cagtggatca cccgcggcct ggccgtggac       240
     gacaccctgt tcggctggct caccacgctg tacccggtgt ggggccagat cgacgccgaa       300
     ctggtgaacg tcgcggccac cggcggcctg tcctggctgg ccgggaccgg ctgcaccacc       360
     accaccgacc atcactacgt cttcccgcgc gacgggggcg acgtgctgaa ggcggagatc       420
     gacgcggcgg cgcgggtggg actgcggttc cacccgaccc gcgggtcgat ggacctgggc       480
     cggagcaagg gcggcctgcc gccggacaac gtggtcgagg acatcgacgc gatcctggcc       540
     gccaccgagg aggcgatcga cacccaccac gacccgtcgt tcggctcgat gctgcggatc       600
     ggggtggccc cctgctcccc gttctcggtg accggcgacc tgctccggca gaccgcggaa       660
     ctctcgcggc gcaagggcgt ccggatgcac acccacctgt gcgagacgct ggacgaggag       720
     cagtactgcc aggagcattt cggctgctcg ccggtggagt acatggagtc ggtggggtgg       780
     ctggggccgg aggtctggct ggcccactcg gtgtggctga ccgacgactc gatcgccagc       840
     ctggcccgca ccggcacctc ggtggcgcac tgccccacct ccaacgcgcg cctgggctcg       900
     ggcatcgccc gggcccggga cctgcgcgac gccggggtgg ccgtcggcct gggcgtcgac       960
     ggggccgcgt ccaacgaggc ctgcgcgctg ctggaggagg cccggcacgc cctgctcttc      1020
     gcccgggcca agggcggtcc gcaggcgttg accgtccgcg atgccctgga catggcgacc      1080
     atgggcggcg cccgggtcct gggccggcag gacgagatcg gctcgctgga ggtgggcaag      1140
     ctggccgaca tcgccgtgtg gcggctggac acgttgccgc acatcgacat cgtcgacccg      1200
     atcgccgccc tggtgctcgg ggccccgccg cccctggagt tgctgctggt cggtggacgg      1260
     ccgatcgtcg agcagggacg cctgagcacc gtggacaccg accgctacgc caccgaggtc      1320
     cgcgacgcca gcaagaaact gctggctcgc gcgggcatct ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page