(data stored in ACNUC30630 zone)

EMBL: CP001737.PE255

CP001737.PE255       Location/Qualifiers
FT   CDS_pept        complement(296202..296441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76693"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK10"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76693.1"
FT                   /translation="MRVVAEFTTEPFHGEGEPPEHAQRAWEVVQAAGLTGDFGPLGTEV
FT                   QGERDTVLDALREVMAAALDAGATRITVQLHTER"
     gtgcgggtcg tcgccgagtt caccaccgag cccttccatg gcgagggcga gccacccgag        60
     cacgcccaac gcgcgtggga ggtcgtccag gcggccggcc tgaccggcga cttcggcccg       120
     ctgggcaccg aggtgcaggg cgagcgggac accgtgctgg acgcgttgcg tgaggtgatg       180
     gccgcggcgc tggacgccgg cgccacccgg atcacggtgc agttgcacac ggagcggtga       240
//

If you have problems or comments...

PBIL Back to PBIL home page