(data stored in ACNUC30630 zone)

EMBL: CP001737.PE260

CP001737.PE260       Location/Qualifiers
FT   CDS_pept        301858..302160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0268"
FT                   /product="urease, gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: rlt:Rleg2_3056 urease, gamma subunit; TIGRFAM:
FT                   urease, gamma subunit; PFAM: Urease gamma subunit region"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76698"
FT                   /db_xref="GOA:C8XK15"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK15"
FT                   /inference="protein motif:TFAM:TIGR00193"
FT                   /protein_id="ACV76698.1"
FT                   /translation="MHLTPADTEKLLLAVAGMVARDRLARGVKLNYPETVALLTTWVIE
FT                   RARDGRSVEELMVAGREVLGRDQVMDGVAEMLPDVQVEATFPDGRKLVTIHQPIA"
     gtgcacctga cccccgccga taccgagaag ctgttgctgg ccgtcgccgg catggtggcc        60
     cgggaccggc tcgctcgcgg cgtcaagctg aactaccccg aaaccgttgc cctgctgacc       120
     acctgggtca tcgagcgggc ccgggacggt cgttcggtcg aggagctcat ggtcgccggg       180
     cgcgaggtgc tcggccggga ccaggtgatg gacggggtgg ccgagatgct gccggacgtc       240
     caggtcgagg ccaccttccc ggacggccgc aagctcgtca ccatccacca accgatcgcc       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page