(data stored in ACNUC30630 zone)

EMBL: CP001737.PE262

CP001737.PE262       Location/Qualifiers
FT   CDS_pept        302527..304230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0270"
FT                   /product="urease, alpha subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: xau:Xaut_4156 urease subunit alpha; TIGRFAM:
FT                   urease, alpha subunit; PFAM: amidohydrolase; Urease
FT                   alpha-subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76700"
FT                   /db_xref="GOA:C8XK17"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK17"
FT                   /inference="protein motif:TFAM:TIGR01792"
FT                   /protein_id="ACV76700.1"
FT                   /translation="MVQISRADYAALYGPTVGDQVRLGDTDLWIEIEQDYTAGGEEAVF
FT                   GGGKSIRESMAQGSTTRAQGAPDTVITNAIILDHWGIVRADVGIRDGRIVAIGRAGNPD
FT                   IADGVHPDLQIGPSTDIISGEGKILTAGGIDTHVHLISPSQIVEALATGLTTLGGGGTG
FT                   PSEGTKATTVTPGAWHLETIHRSIDPYPINLLLLGKGNTVSMAGLKEQALAGAGGYKVH
FT                   EDWGSTPAAIDAALRAADEWGLQVALHSDSLNESGYVASTIAAIGGRSISAFHVEGAGG
FT                   GHAPDILTLAGLPNVIPGSTNPTLPHTVNTVAEHLDMLMVCHHLNPAVPEDLAFAESRI
FT                   RATTIAAEDILHDMGAVSLTSSDAQAMGRIGEVVCRTWQVAHVMKNRRGDIGGGLPADN
FT                   FRARRYIAKYTINPAITHGIDHEVGSVEPGKLADLVLWEPKFFGIRPAVVLKGGGLVWG
FT                   ALGDPNASIPTPQPVLMRPALTDAIGAQLSLSFVSPFALEDGLADRLGLRRKLSAVKPT
FT                   RDVGKAQMINNDALPDIVIKPDTFEISIDGEVVVPAPAQRLPLAQLYSLF"
     atggtgcaga tctcgcgcgc ggactatgcc gccctctacg ggccgacggt cggcgaccag        60
     gtccggctgg gcgacaccga cctgtggatc gaaatcgagc aggactacac cgccggtggt       120
     gaggaggcgg tgttcggcgg cggcaagtcg atccgggaat ccatggccca gggcagcacc       180
     acccgggcgc agggtgcccc ggacacggtc atcaccaacg cgatcatcct ggaccactgg       240
     ggcatcgtcc gggccgacgt cggcatccgg gacggccgga tcgtggccat cggccgggcc       300
     ggcaacccgg acatcgccga cggggtgcac ccggacctgc agatcgggcc gtccaccgac       360
     atcatctccg gcgagggcaa gatcctcacc gcgggcggca tcgacaccca cgtgcacctg       420
     atctcgccgt cgcagatcgt cgaggccctg gcgaccgggc tgaccaccct cggtggcggc       480
     ggcaccgggc cgtccgaggg caccaaggcg acgacggtga ccccgggcgc gtggcacctt       540
     gagaccattc accggtcgat cgatccgtac ccgatcaacc tgctgctgct cggcaagggc       600
     aacacggtct cgatggcggg cctcaaggag caggccctgg ccggggccgg cgggtacaag       660
     gtgcacgagg actggggttc caccccggcc gcgatcgatg ccgccctgcg cgcggccgac       720
     gagtggggcc tgcaggtcgc gctgcactcc gactcgctca acgaatccgg ctacgtggcc       780
     tccacgatcg cggccatcgg cggccggtcg atcagcgcgt tccacgtgga gggcgccggc       840
     ggcgggcacg ccccggacat cctgacgctg gccgggctgc ccaacgtgat ccccgggtcc       900
     accaacccga cgctgccgca cacggtcaac acggtcgccg aacacctgga catgttgatg       960
     gtgtgccatc acctcaaccc ggcggtgccc gaggacctgg ccttcgccga gtcccggatc      1020
     cgggcaacca cgatcgccgc cgaggacatc ctgcacgaca tgggcgcggt gtccctgacc      1080
     tcgtcggatg cgcaggcgat gggccggatc ggcgaggtgg tctgccggac ctggcaggtc      1140
     gcgcacgtga tgaagaaccg gcggggcgat atcggcggcg gcctgcccgc ggacaacttc      1200
     cgggcccgcc ggtacatcgc caagtacacg atcaacccgg cgatcaccca cggcatcgac      1260
     cacgaggtcg gatcggtcga gccgggcaag ctggccgacc tggtgctctg ggagcccaag      1320
     ttcttcggca tccggccggc cgtggtgctc aagggcggcg gcctggtctg gggcgcactg      1380
     ggcgatccga atgcgtcgat cccgacgccg cagccggtgc tgatgcggcc ggcgctgacc      1440
     gacgcgatcg gggcccagct ctcgctctcg ttcgtctcgc cgttcgccct cgaggacggg      1500
     ctggccgatc gactcggcct gcgccgcaag ctgtccgcgg tcaagccgac ccgggacgtg      1560
     ggcaaggcgc agatgatcaa caacgacgcg ctgccggaca tcgtgatcaa gccggatacc      1620
     ttcgagatct ccattgacgg cgaggtcgtc gtgcccgccc cggcgcagcg gctgcccctg      1680
     gcccagctgt actcgctgtt ctga                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page