(data stored in ACNUC30630 zone)

EMBL: CP001737.PE263

CP001737.PE263       Location/Qualifiers
FT   CDS_pept        304331..304804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0271"
FT                   /product="regulator of ribonuclease activity A"
FT                   /note="TIGRFAM: regulator of ribonuclease activity A; PFAM:
FT                   Dimethylmenaquinone methyltransferase; KEGG: tgr:Tgr7_2551
FT                   ribonuclease activity regulator protein RraA"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76701"
FT                   /db_xref="GOA:C8XK18"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK18"
FT                   /inference="protein motif:TFAM:TIGR01935"
FT                   /protein_id="ACV76701.1"
FT                   /translation="MSTADLYDEYGERLQSCDTQFRQFGGRRDFDGIVATVRCFQDNAL
FT                   LKSILGTPGQGRVLVIDGGGSVHTALTGDLIAQLAVDHGWAGLVINGAVRDSVALGALP
FT                   LGIKALGTNPRKSSKTGAGEHEVDLEFGGAIFRPGDHVWCDDDGVVVLPAAAQ"
     atgagtacgg cagatctgta tgacgagtac ggcgagcgcc tgcagtcctg cgacacgcag        60
     ttccggcagt tcggcggacg ccgtgatttc gacggaatcg tggccacggt gcggtgtttc       120
     caggacaacg cgctgctcaa atcgatcctg ggcacccccg gccagggtcg ggtgctggtg       180
     atcgacggcg ggggatcggt gcacaccgcg ttgaccggcg acctgatcgc ccagctcgcc       240
     gtcgaccacg gttgggccgg gctggtgatc aacggtgcgg tgcgggacag cgtcgcgctc       300
     ggcgccctgc cgctgggcat caaggcgttg ggcaccaacc cgcgcaagag cagcaagacc       360
     ggagccggcg agcacgaggt cgacctcgag ttcggcggcg cgatcttccg gcccggcgac       420
     cacgtctggt gcgacgacga cggggtggtc gtcctgcccg ccgcggcgca atga             474
//

If you have problems or comments...

PBIL Back to PBIL home page