(data stored in ACNUC30630 zone)

EMBL: CP001737.PE267

CP001737.PE267       Location/Qualifiers
FT   CDS_pept        307175..307897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0275"
FT                   /product="Urease accessory protein UreH-like protein"
FT                   /note="KEGG: rpb:RPB_1799 urease accessory protein UreD"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76705"
FT                   /db_xref="GOA:C8XK22"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK22"
FT                   /inference="protein motif:COG:COG0829"
FT                   /protein_id="ACV76705.1"
FT                   /translation="MTLIAVDPAPGRARVTHTPGPIAARVQRVDQAGARVALVATTALL
FT                   LGGDRVELDVRVGPGGWLDVVETAGTVAYDAQGIASSWLIRADLAAGATLTWSGEPLVV
FT                   ADGARVHRSTTLDLAAGASACLRETLVFGRVGEAGGALRATTRVRHEGADLLVEDLDLP
FT                   DGAARRAPGRLGPARVIDTVLLLGRQAAPTPVLPAGTRYDLAGPGTVARVLAGDTDRGG
FT                   LDPVWRQWCADQAGQRRS"
     gtgacgctca tcgccgtcga cccggccccc ggccgggcgc gggtcactca taccccgggg        60
     ccgatcgccg cccgggtgca gcgggtcgat caggccggcg cccgggtcgc cctggtcgcc       120
     accaccgcgc tgctgctcgg tggtgatcgc gtcgagctgg acgtgcgggt gggccccggc       180
     ggctggctgg acgtggtgga gaccgccggc accgtggcct acgacgccca ggggatcgcg       240
     tccagctggc tcatccgggc cgacctggcc gccggcgcca ccctgacctg gagcggtgag       300
     ccgttggtcg ttgccgacgg ggcccgcgtg caccgctcga ccaccctgga cctggccgcc       360
     ggggccagcg cctgcttgcg cgagaccctg gtgttcggcc gggtcggcga ggccggtgga       420
     gccctgcggg ccaccacccg ggtccggcac gagggcgccg acctgctggt cgaggacctg       480
     gacctgccgg atggggccgc ccgccgcgcc cccggccggc tcggccccgc tcgggtgatc       540
     gacaccgtgc tgctgctggg tcgccaggcc gcgcccaccc cggtcctgcc cgccggcacc       600
     cggtacgacc tggccggccc ggggaccgtg gcccgagtac tggccggcga caccgaccgc       660
     ggcggcctgg acccggtgtg gcggcagtgg tgcgccgatc aggccggcca gcggcgcagc       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page