(data stored in ACNUC30630 zone)

EMBL: CP001737.PE277

CP001737.PE277       Location/Qualifiers
FT   CDS_pept        318911..319981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0285"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="KEGG: mpo:Mpop_4397 agmatinase; TIGRFAM: agmatinase;
FT                   PFAM: Arginase/agmatinase/formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76715"
FT                   /db_xref="GOA:C8XK32"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK32"
FT                   /inference="protein motif:TFAM:TIGR01230"
FT                   /protein_id="ACV76715.1"
FT                   /translation="MGMARYGSMYGPDITFTGVPRCDLADPASYTDAVAVILGAPYDAG
FT                   TSYRAGARMGPMALRSCDYSEHTGSRPHLALRVDPLLDLGVVDAGDVEMAPTETQRSLA
FT                   ALQDAVLTLARAGKIPVVLGGDHTVAQPDITALAEHFGYGRLAVIHFDAHADTGDIQFG
FT                   SLYGHGLPMRRVIESGAVRGEKFLQIGLRGYWPEPPELAWMAEQGMRCYEMAEIARRGL
FT                   DRVLTEAMTIATQDTDGVYLSVDIDVCDPAAAPGTGTPEPGGLTARELLDAVRRIGRAV
FT                   PLVGLEIVEVAPPYDHADITAMLGNRVVLETLSGIARRRADAAAGTVWDEATPLMAGRV
FT                   SAAPPPVEPPEHERSL"
     atgggtatgg ccagatacgg ctcgatgtac ggaccggaca tcaccttcac cggggtgccg        60
     cgctgcgacc tggctgatcc ggccagctat accgacgcgg tcgcggtgat cctgggggcg       120
     ccgtacgacg ccggcacctc ataccgggcc ggggcgcgga tggggccgat ggccctgcgc       180
     agctgcgatt actccgagca caccggctcc cggccgcacc tggccctgcg ggtggatccg       240
     ctgctggacc tcggggtcgt cgacgccggt gacgtcgaga tggccccgac cgagacccag       300
     cggtcattgg ccgccctgca ggacgccgtg ctgacgctgg cccgggccgg caagatcccg       360
     gtcgtgctgg gtggtgacca caccgtcgcc cagcccgaca tcaccgcact ggccgagcat       420
     ttcggctacg gtcggctggc cgtcatccac ttcgatgcgc acgccgacac cggcgacatc       480
     cagttcggct cgctgtacgg gcacggcctg ccgatgcgcc gggtgatcga gtccggcgcg       540
     gtgcggggcg agaagttcct gcagatcggc ctgcgcgggt attggccgga accgcccgag       600
     ctggcctgga tggccgagca gggcatgcgc tgctacgaga tggccgagat tgcccgccgt       660
     ggcctggatc gcgtgctcac cgaggccatg acgatcgcca cccaggacac cgacggggtc       720
     tacctgtcgg tggacatcga tgtctgcgac ccggccgccg cgcccggtac cggcaccccc       780
     gaacccggcg ggctgaccgc ccgcgaactg ctcgacgcgg tccggcggat cggccgggcg       840
     gtgccgttgg tgggcctgga aatcgtcgag gtggccccgc cgtacgacca cgcggacatc       900
     acggcgatgc tgggcaaccg ggtggtgctg gaaaccctgt ccggcatcgc ccgccgccgg       960
     gccgacgcgg ccgccggcac cgtctgggac gaggcgaccc cgctgatggc cggccgggtg      1020
     tcggccgccc cgccgccggt ggagccaccg gagcacgagc gctcgctctg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page