(data stored in ACNUC30630 zone)

EMBL: CP001737.PE282

CP001737.PE282       Location/Qualifiers
FT   CDS_pept        323903..324562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0290"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   scl:sce7213 ribosomal-protein-serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76720"
FT                   /db_xref="GOA:C8XK37"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK37"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACV76720.1"
FT                   /translation="MSTKLRTLADYWPIFGLRLASPRLVLAPLQDADLPETLDLILAGI
FT                   HDRASMPFAMPWTDVPPDELVAGALRHYWSTRASATPQRWTVPFLVRRQGVAVGLQDLS
FT                   GTDFAVTRTVHTGSWLGRAHQGQGLGTEMRSAVVQFAFDHLKAERADSAAFSDNPTSLA
FT                   VSRKLGYRADGTAVVQRRPGERAVEQRLTLDRASFVRPGWMVQVRGLPACQAFFGT"
     gtgagcacga agctacggac gctggccgac tactggccca tcttcgggct gcggctggcc        60
     tccccgcggc tggtgctggc cccgctgcag gatgccgacc tgccggagac cctggacctg       120
     atcctggccg gcatccacga tcgcgcgtcg atgccgttcg cgatgccgtg gaccgacgtg       180
     ccaccggacg agctggtcgc cggcgcgttg cgtcactact ggtcgacccg ggcctcggcc       240
     actccgcagc gctggacggt gccgttcctc gtccgccgcc agggcgtcgc ggtcggtctg       300
     caggacctgt cgggtaccga cttcgcggtc acccgcacgg tgcacaccgg gtcctggctc       360
     ggccgggccc accaggggca gggcctgggc accgagatgc gctccgcggt ggtccagttc       420
     gccttcgacc acctcaaggc cgagcgggcg gacagtgccg cgttcagcga caacccgacg       480
     tcgctggccg tttcccgcaa gctcgggtac cgggcggacg gcaccgccgt ggtgcagcgg       540
     cggccgggcg agcgggcggt cgagcagcgg ctcaccctgg accgggcctc gttcgtccgg       600
     cccggctgga tggtgcaggt ccgtggcctg cccgcctgcc aggccttctt cgggacctga       660
//

If you have problems or comments...

PBIL Back to PBIL home page