(data stored in ACNUC30630 zone)

EMBL: CP001737.PE284

CP001737.PE284       Location/Qualifiers
FT   CDS_pept        325352..326218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0292"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: mlo:mlr1493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76722"
FT                   /db_xref="GOA:C8XK39"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK39"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACV76722.1"
FT                   /translation="MDRIPAPALFLTSGLTQYVGAALAVGLFATIPAASVAWWRIAVSA
FT                   VVLMAWRRPWRQAWTRSDLVGAAVFGIVLATMNVTFYIAIDHLPLGTAVAIEFLGPVAV
FT                   AGLTGHGWRDRAGIALAAGGVVLLAGVQVEGGVTGSTAIGLVAIMGSAVSWAGYILLGR
FT                   RMAVRRDGISSLAVGMTAGAVVWVPLAFGAFLPVVTDPARAAAVVGVAVLSSVIPYVLE
FT                   QLVLRRVTAARFAILLAMLPVTAALIGAVLLAQIPTGFELAGMALVCVAIVLSGQRPAP
FT                   PESPLPG"
     gtggatcgga tccccgcgcc cgctctgttc ctgacctccg ggctgaccca gtacgtgggg        60
     gccgcgctcg ccgtcgggct gttcgcgacg atcccggccg cgtcggtggc ctggtggcgg       120
     atcgccgtgt cggccgtggt gctgatggcc tggcgccgcc cgtggcggca ggcctggacc       180
     cgcagcgacc tggtcggggc ggcggtcttc ggcatcgtgc tggccacgat gaacgtcacc       240
     ttctacatcg cgatcgacca tctgccgctg gggacggcgg tggcgatcga gttcctcggg       300
     ccggtcgccg tggccggcct gaccggccac ggttggcggg accgggccgg catcgccctg       360
     gccgccggcg gggtcgtgct gctggccggc gtgcaggtgg aggggggcgt caccggctcg       420
     acggcgatcg gcctggtcgc gatcatgggg tcggcggtgt cctgggccgg ctacatcctg       480
     ctgggccggc ggatggcggt gcggcgggac ggcatcagtt cgctggccgt gggcatgacc       540
     gccggcgcgg tggtgtgggt gccgttggcc ttcggcgcgt tcctgccggt ggtgaccgat       600
     ccggcccggg cggccgcggt cgtcggcgtg gccgtgctga gctcggtgat cccgtacgtc       660
     ctggagcaac tcgtgttgcg ccgggtcacc gccgcccgat tcgccatcct gctggccatg       720
     ctgccggtca ccgcggcact gatcggcgcc gtcctgctgg cccagatccc gaccgggttc       780
     gagctggccg gcatggccct ggtctgcgtg gccatcgtgc tgtccggcca gcggccggcg       840
     ccgccggaga gcccgctgcc gggctga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page