(data stored in ACNUC30630 zone)

EMBL: CP001737.PE289

CP001737.PE289       Location/Qualifiers
FT   CDS_pept        complement(330361..331152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0297"
FT                   /product="protein of unknown function DUF1365"
FT                   /note="PFAM: protein of unknown function DUF1365; KEGG:
FT                   mlo:mll8086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76727"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK44"
FT                   /inference="protein motif:PFAM:PF07103"
FT                   /protein_id="ACV76727.1"
FT                   /translation="MTVPSARADRRRSPTRLAARIYDARTTHRRTVAAPAQVDRRFDYR
FT                   TCYWLIDLDEPPVLPGVLRRLVRFEARDHLGDPAATIATNARARLAEHDLAADRILLLT
FT                   CPRTFGHVFNPLSVYYCLRRQDAGEELVAVIAEVHNTYGGRHTYLLRPDQAGADEVDKQ
FT                   FYVSPFLPMGGSYTMRTPLPEERLAVSITLHQDGATPFVATLTGPGRPLTPASAVRAVL
FT                   RWPVLTLRTSALIRWQGIRLWLRRVPVQPRPADAAADERGR"
     gtgacggtgc cgtccgcccg cgccgatcgt cgtcgcagtc cgacccggct ggcggcgcgg        60
     atctacgacg cccgcaccac ccaccggcgg acggtggccg ccccggcgca ggtggaccgc       120
     cgcttcgact accgcacctg ttactggctc atcgacctgg acgagccgcc cgtgctgccc       180
     ggtgtcctgc gccggctggt ccggttcgag gcccgggacc acctcggcga tccggccgcg       240
     acgatcgcca cgaacgcccg ggcgcggctg gccgagcacg acctggccgc cgaccggatc       300
     ctgctgctga cctgcccacg cacgttcggg cacgtgttca acccgctgtc ggtctattac       360
     tgcctacgcc gccaggacgc cggcgaggag ctcgtcgcgg tgatcgccga ggtgcacaac       420
     acctacggcg gccggcacac ctacctgctg cggccggacc aggccggtgc cgacgaggtg       480
     gacaagcagt tctacgtctc accgttcctg cccatgggcg gcagctacac catgcgcacc       540
     cccctgccgg aggaacggtt ggcggtgtcg atcaccctgc accaggacgg ggcgacgccg       600
     ttcgtggcca ccctgaccgg tcccggccgg ccgctgaccc cggcatccgc cgtccgcgcg       660
     gtgctgcgct ggcccgtgct caccctgcgc accagtgcgc tgatccgctg gcagggcatc       720
     cggttgtggc tgcgccgggt gcccgtgcaa ccccggccgg ccgacgccgc cgcggacgag       780
     cggggtcgct ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page