(data stored in ACNUC30630 zone)

EMBL: CP001737.PE296

CP001737.PE296       Location/Qualifiers
FT   CDS_pept        336426..338429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0304"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="TIGRFAM: acetoacetyl-CoA synthase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: sil:SPO1959
FT                   acetoacetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76734"
FT                   /db_xref="GOA:C8XK51"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK51"
FT                   /inference="protein motif:TFAM:TIGR01217"
FT                   /protein_id="ACV76734.1"
FT                   /translation="MTGNDVVPEVLWSPSKERIARAAITDFADFVSDRTGRTFDDYAAL
FT                   WDYSTGEPADFWGAIADYFQVRWHEQPTEVLPDVSMPGARWFPGGTLNYAEHALAEPAE
FT                   PVAGEPAIIAVAEDGSEQQLTRADLRRQVGAVQAGLRRLGVGQGDRVVALVPNTVHALV
FT                   GFLATAALGAVWSSCSPDFGAPSVIDRFTQISPTVLIAVDGYRYGGKAFPVAETVTKLR
FT                   EALPSLAGAVHVPALGTDVPAGMIGWDELTAQAAEQTFTPVPFDAPLWVLYSSGTTGLP
FT                   KPIVHSVGGILVEHLKSLRLHWDLGRGDRFLWFTTTGWMMWNFLIGGLLVDATVILYDG
FT                   SPGHPDLMTLWRLAEKHRVTLFGTSAPFVAASQKAGLRPAAELDLSSVTAIGSTGSPLS
FT                   TSGFRWIRDEVGADIQIASFSGGTDVCTGVVGGAPTVPVWMGEISCRALGAKVESYSPT
FT                   GEPLIDEVGELVITAPMPSMPVFFWGDEDGSRLRDSYFDDYPGVWRHGDWIRITSRGSC
FT                   VIEGRSDATLNRGGVRMGTAEFYRVVESLHEVADSLVVDTSTAAGEGDLLLFVVLAPDA
FT                   DPVAVTGSVKKLIRQELSPRHVPGAVVAVPAVPRTLNGKKCEVPVKRILGGMAVDTAVS
FT                   RDALADPAGFDEFIRVAQESANRSAAGRGSTG"
     atgactggaa acgatgtggt tcctgaggtg ttgtggtcgc cgagcaagga gcggatcgcc        60
     cgcgcggcca tcaccgactt cgccgatttc gtcagcgacc ggaccggccg gaccttcgac       120
     gactacgccg ccctctggga ctactcgacc ggcgagccgg ccgatttctg gggggcgatc       180
     gccgactact tccaggtccg gtggcacgag cagcccaccg aggtgcttcc tgacgtgtcg       240
     atgcccgggg ctcgctggtt cccgggcggc accctgaact acgccgagca cgcgctggcc       300
     gagccggccg aaccggtggc cggggagccg gcgatcatcg cggtcgccga ggacggcagc       360
     gagcagcagc tgacccgggc cgacctgcgc cggcaggtcg gtgcggtcca ggccggcctg       420
     cgccggctcg gggtcggtca aggcgatcgg gtcgtcgccc tggtgccgaa tacagtgcac       480
     gccctggtcg gcttcctggc caccgccgcg ctcggcgccg tgtggtcgtc ctgctcgccg       540
     gacttcggtg ccccgtcggt gatcgaccgg ttcacccaga tctcgccgac cgtgctgatc       600
     gccgtggacg ggtaccgcta cggcggcaag gccttcccgg tcgccgagac ggtgaccaag       660
     ctgcgcgagg cgttgccgtc gctggccggg gcggtgcacg tgccggcgct gggcaccgac       720
     gtgcccgccg gcatgatcgg ctgggacgag ctcaccgcgc aggcggccga gcagaccttc       780
     accccggtgc cgttcgacgc gccgctgtgg gtgctgtact cctccggcac caccggcctg       840
     cccaagccga tcgtgcactc ggtcggcggg atcctggtcg agcacctcaa atcgttgcgg       900
     ctgcactggg acctgggtcg gggcgatcgc ttcctgtggt tcaccaccac gggctggatg       960
     atgtggaact tcctgatcgg cgggctgctg gtcgacgcca ccgtcatcct ctacgacggc      1020
     agccccgggc accccgacct gatgacgctc tggcggctgg ccgagaagca ccgggtcacc      1080
     ctgttcggca cgtccgcgcc gttcgtcgcg gccagccaga aggccggtct gcgcccggcc      1140
     gccgagctgg acctgtccag cgtcaccgcc atcggctcga ccggatcgcc gttgtccacc      1200
     agcggtttcc ggtggatccg ggacgaggtc ggggcggaca tccagatcgc ctccttctcc      1260
     ggcggcaccg acgtgtgcac cggagtggtg ggcggcgcgc cgaccgtgcc ggtgtggatg      1320
     ggcgagatct cctgccgggc cctgggcgcc aaggtcgagt cgtactcgcc gaccggtgag      1380
     ccgctgatcg acgaggtcgg cgaactggtg atcaccgcgc cgatgccgtc gatgccggtg      1440
     ttcttctggg gcgacgagga cggaagccgg ctgcgcgact cgtatttcga cgactacccg      1500
     ggggtgtggc ggcacgggga ctggatccgg atcacctcgc gggggtcctg cgtgatcgag      1560
     ggccggtccg acgccacgct caaccgcggc ggcgtgcgga tgggcaccgc cgagttctac      1620
     cgggtggtcg aatcgctgca cgaggtcgcc gactcgttgg tggtggacac ctcgaccgcg      1680
     gccggggagg gtgatctgct gctgttcgtg gtgctggccc ccgacgccga cccggtcgcc      1740
     gtcaccggtt cggtgaagaa gctgatccgg caggaactct cgccccggca cgtgcccgga      1800
     gcggtggtgg cggtgccggc cgtgccgcgc accctgaacg gcaagaagtg cgaggtgccg      1860
     gtcaagcgga tcctgggcgg catggcggtc gacacggccg tgtcccggga cgcgttggcc      1920
     gacccggccg gcttcgacga gttcatccgg gtggcccagg aatcggccaa ccgatcagct      1980
     gcgggaaggg gatccaccgg gtga                                             2004
//

If you have problems or comments...

PBIL Back to PBIL home page