(data stored in ACNUC30630 zone)

EMBL: CP001737.PE300

CP001737.PE300       Location/Qualifiers
FT   CDS_pept        complement(340107..342083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0308"
FT                   /product="PTS system, glucose-like IIB subunint"
FT                   /note="TIGRFAM: PTS system, glucose-like IIB subunint;
FT                   PFAM: phosphotransferase system EIIC; phosphotransferase
FT                   system PTS EIIB protein; KEGG: cvi:CV_0979 protein-N
FT                   p-phosphohistidine- sugar phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76738"
FT                   /db_xref="GOA:C8XK55"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK55"
FT                   /inference="protein motif:TFAM:TIGR00826"
FT                   /protein_id="ACV76738.1"
FT                   /translation="MTTTLEKTPAAEPAAPAPNKLKEIWSNFFGFLQKLGKSLMLPVAV
FT                   LPVAGILLGVGGAFLGNYNQQAINAGYCSAPGGITISGDAAACLALPSDTVVGDPVAAG
FT                   ILAEPLYVFLKILQGAGDPVFGALGLIFAVGVALGISKNDGVSALAATVGYLVMTATIG
FT                   VVAQARGIDTKAVLGLQTLDTGVFGGIIIGIIAGYLFNRFYRISLPPYLGFFAGKRFVP
FT                   IVTAFAAIALGVVLAFLWPPIGNFIENTANEVISANAPVAVFVYALVERALLPFGLHHI
FT                   WNAPFFYVVNIGGWSNCEGILTCFLRGHPESGIFGGGFLGKMFGLCGAALAIYVTAKPE
FT                   NKVKIGSIMLAAALTTFLTGITEPLEFAFLFVAPLLYVAHALMYASGFTVMYLLGGRLG
FT                   YTFSQGGIDYVLFYANGIKPWLVLVIGPIWFVLYFAVFYGLIKLLNMKTPGREEAEVDV
FT                   GEAAADGANRFSQQLVLAFGGRSNITDLDACITRLRVGVVDINKASQSKLRALGAAGVL
FT                   IVGNNMQAIFGTRSENLKTDIEEYLKIAGDEAELGDDQIEEVVYDEPGTKPKLRDPLAA
FT                   EKSRDFIAGLGGRDNISKVEAAAETRLRVKVKDGSKVDEAALANSGIAGVVKVGDGLYH
FT                   LIAGANADQYAAEMRGQLVSVPA"
     atgacgacca cgttggaaaa gactccggcg gccgaaccgg ccgcgccggc cccgaacaaa        60
     ctcaaggaaa tctggagcaa cttcttcggc ttcctgcaga agctgggcaa gtcgctgatg       120
     ctgcccgtcg ccgtgctgcc ggtcgccggg atcctgctcg gcgtcggcgg tgccttcctg       180
     ggcaactaca accagcaggc catcaacgcc ggctactgca gcgctccggg cgggatcacc       240
     atctccggtg acgcggccgc ctgcctggcg ttgccctcgg acaccgtcgt cggcgatccg       300
     gtcgccgccg gcatcctggc cgaaccgctg tacgtgttcc tgaagatcct gcagggcgcc       360
     ggcgacccgg tcttcggcgc gctcggcctg atcttcgcgg tcggtgtggc gctgggcatc       420
     tccaagaacg acggcgtctc cgcgctggcc gccaccgtcg gctacctggt catgacggcc       480
     accatcggtg tcgtcgccca ggcccgcggg atcgacacca aggccgtgct gggcctgcag       540
     acgctggaca ccggcgtgtt cggcggcatc atcatcggca tcatcgccgg gtacctgttc       600
     aaccggttct atcgcatcag cctgccgccc tatctgggct tcttcgccgg taagcgtttc       660
     gtgcccatcg tcaccgcctt cgccgccatc gcgctcggcg tggtgctggc cttcctgtgg       720
     ccgccgatcg gcaacttcat cgagaacacc gccaacgagg tgatcagcgc caacgccccg       780
     gtcgcggtgt tcgtctacgc gctggtggaa cgcgcgctgc tgccgttcgg tctgcaccac       840
     atctggaacg cgccgttctt ctacgtggtc aacatcggcg ggtggagcaa ctgcgaaggc       900
     atcctgacct gcttcctgcg cgggcatccc gagtccggca tcttcggcgg tggcttcctg       960
     ggcaagatgt tcgggctgtg cggcgcggcg ctggcgatct acgtgaccgc caagccggag      1020
     aacaaggtca agatcggctc gatcatgctg gccgcggcgc tgaccacgtt cctgaccggg      1080
     atcaccgagc cgctggagtt cgccttcctg ttcgtcgcgc cgctgctgta cgtggcgcac      1140
     gccctgatgt acgcctccgg cttcaccgtg atgtacctgc tcggcggccg gctcggatac      1200
     acgttctccc agggcggcat cgactacgtg ctgttctatg ccaacggcat caaaccctgg      1260
     ctggtgctgg tcatcgggcc gatctggttc gtcctgtact tcgccgtgtt ctacgggttg      1320
     atcaagctgc tcaacatgaa gaccccgggc cgcgaggagg ccgaggtcga cgtcggcgag      1380
     gcggccgcgg acggggccaa ccggttctcc cagcagctcg tgctggcctt cggcgggcgc      1440
     agcaacatca ccgacctgga cgcctgcatc acccggctgc gcgtcggcgt ggtcgacatc      1500
     aacaaggcca gccagagcaa gctgcgggcg ttgggtgccg cgggtgtgct catcgtcggc      1560
     aacaacatgc aggcgatctt cgggacccgg tcggagaacc tgaagaccga catcgaggag      1620
     tacctcaaga tcgccggcga cgaggccgaa ctcggcgacg accagatcga ggaagtcgtc      1680
     tacgacgaac ccggcaccaa gcccaagctg cgcgacccct tggcggcgga gaagtcgcgg      1740
     gacttcatcg ccggcctggg cggccgggac aacatcagca aggtcgaggc ggcggccgag      1800
     acccggctgc gggtcaaggt caaggacggc tccaaggtcg acgaggcggc cctggccaac      1860
     agcggcatcg ccggggtggt caaggtcggc gacggcctct accacctgat cgccggggcc      1920
     aacgccgacc agtacgcggc cgagatgcgc ggccagctcg tgtcggtacc tgcctga         1977
//

If you have problems or comments...

PBIL Back to PBIL home page