(data stored in ACNUC30630 zone)

EMBL: CP001737.PE303

CP001737.PE303       Location/Qualifiers
FT   CDS_pept        345515..346408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0311"
FT                   /product="WD40 domain protein beta Propeller"
FT                   /note="PFAM: WD40 domain protein beta Propeller; KEGG:
FT                   sfu:Sfum_0755 TolB, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76741"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK58"
FT                   /inference="protein motif:PFAM:PF07676"
FT                   /protein_id="ACV76741.1"
FT                   /translation="MPRSAPLTDTQLIATRNEDDKNDLSVIDTTTGMVVGKLTDGSPGS
FT                   QYPTMSPDRSTIVYAQTSDHGIELRMMAADGSGDRSLLAADSEFCPNPQRPAWNPMDTS
FT                   EIAVACRRGEDPDTLALISVDGTLRSTINTGFPSFDDPTYSPDGKTLAYWASQTPGSTS
FT                   GAIYTQPVNGSEAPKQITSPGARANDVDPVWSVDGKTIYFRRATEDASGQSSAQILRVQ
FT                   ADGSGLTPITDGTAFDNDPSVSPDGTQLAFFSNRTNAAGNNAGQIWVINVDGTGLRQIG
FT                   IGKPGTASGPPEWSRR"
     gtgccccggt ccgctccgct caccgacacg cagttgatcg ccacccggaa cgaggacgac        60
     aagaacgacc tgtccgtgat cgacacgaca accggcatgg tcgtcggcaa gctcaccgac       120
     ggctcgcccg ggtcgcagta tccgacgatg tctcccgacc ggagcaccat cgtctacgcc       180
     cagacaagcg atcacggcat cgaattgcgc atgatggcag cggatggaag tggcgaccga       240
     tccctgctgg ccgcggactc ggagttctgc ccgaacccgc aacgaccggc ctggaacccc       300
     atggacacct cggagatcgc ggtcgcctgc cgccggggcg aggatccgga cacccttgcg       360
     ctgatcagcg tggacggcac cttgcgcagc accatcaaca ccgggtttcc gtccttcgac       420
     gatccgacgt actcgcccga cggcaagacc ttggcgtact gggcgtcgca gacccccggg       480
     agcacgagcg gcgccatcta cacgcaaccg gtcaacggaa gtgaggcgcc caagcagatc       540
     acctcgccgg gtgcccgggc gaacgatgtc gaccccgtgt ggagcgttga tggcaagacc       600
     atctatttcc gccgagccac cgaagacgct tccggtcagt cctcagcgca gatcctccgc       660
     gtccaggccg acggatccgg tctgaccccg atcactgacg gtacggcttt cgacaacgat       720
     ccgtcggtct cacccgatgg cacccagttg gccttcttca gcaacaggac caacgcggcc       780
     ggcaacaatg ccggccagat ctgggtgatc aacgtcgacg gaaccggctt gcggcagatc       840
     ggcatcggaa agcccgggac ggccagcggc ccgcccgagt ggagccggcg ctga             894
//

If you have problems or comments...

PBIL Back to PBIL home page