(data stored in ACNUC30630 zone)

EMBL: CP001737.PE304

CP001737.PE304       Location/Qualifiers
FT   CDS_pept        complement(346419..346997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_3660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76742"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK59"
FT                   /inference="similar to AA sequence:KEGG:MXAN_3660"
FT                   /protein_id="ACV76742.1"
FT                   /translation="MPAPDATAVLELPDAEAWERWLSANHDQAREAWLRIARRGSGAPL
FT                   IDIADALDVALCWGWIDGQRRAHDATSFRQRYCPRRPRSAWSQVNVGKVEVLIAAGRMR
FT                   PPGLAQIDAAKADGRWAAAYERQRTAEPPPDLIAALAENPPAQSAFDALSRTDRYLVIL
FT                   ALAKARTPAARARTLAAAVARLAAAADHD"
     atgcccgccc ccgatgccac ggccgtgctg gagttgcccg acgccgaggc ctgggagcgg        60
     tggctgtcag ccaaccacga tcaggcccgg gaggcctggc tgagaatcgc ccgccgggga       120
     tccggggcgc cgctgatcga catcgccgac gcgctggacg tggcgctgtg ctggggttgg       180
     atcgacggcc aacgccgcgc ccacgatgcg acctcgttcc ggcaacgcta ctgcccccga       240
     cgaccacgca gcgcctggtc gcaggtcaac gtgggcaagg tggaggtgtt gatcgccgcc       300
     ggccggatgc ggccacccgg cctcgcccag atcgacgcgg ccaaggccga cggccgctgg       360
     gcggccgcct acgagcgcca gcgcaccgcc gaaccaccac ccgatctgat cgccgccctc       420
     gccgagaatc cgcccgcgca aagcgccttt gatgcgctga gccggaccga ccggtacctg       480
     gtgatcctgg ccctggccaa ggcccgcacg cccgccgctc gcgcccgcac cctggccgcg       540
     gcggtggccc ggctggcggc cgcggccgac cacgactga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page