(data stored in ACNUC30630 zone)

EMBL: CP001737.PE310

CP001737.PE310       Location/Qualifiers
FT   CDS_pept        353174..354205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0318"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csa:Csal_1174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76748"
FT                   /db_xref="GOA:C8XK65"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK65"
FT                   /inference="similar to AA sequence:KEGG:Csal_1174"
FT                   /protein_id="ACV76748.1"
FT                   /translation="MTIAPPPPPPPSPLPVADRRRPDRARWWPRLQLLGGALVVVIVLR
FT                   QLGTGPFLAGLAALTVPAVLAAMVIGAVTTVACAWRWRIVAERLGLRLRWGPAIAAYYG
FT                   SQFLNSTLPGGVLGDVDRAVRHGRTVEDVGRGARAVAGERAAGPLVHVGLTVLVVALVP
FT                   GPALSWLLGPVILLGGLLIVAGAVLLIARGTSRWSRLAGVVAADLRTGVLAREAWPRIL
FT                   LASVVVAVGPAVLFVIAARLVGVPAGALELVPVAMVVLAAMLVPINVGGWGPRESVAAA
FT                   VFGAAGWGAGTGVAAATAFGALTLIATTPGLVVLLARPLSRSTLARSIRTRSAGRTREV
FT                   GDE"
     atgacgatcg ccccgccccc gcccccgccc ccgtccccgc tgccggtcgc cgaccgtcgc        60
     cgtcccgatc gggcgcgctg gtggcctcgc ctgcagctgc tcggcggggc cctggtggtg       120
     gtcatcgtcc tgcggcagct gggcacgggc ccattcctgg ccggcctggc cgcgctgacc       180
     gtcccggccg tgctggccgc gatggtgatc ggcgcggtga ccacggtggc ctgcgcgtgg       240
     cggtggcgaa tcgtcgccga acggctgggt ctgcgcctgc ggtgggggcc ggcgatcgcc       300
     gcctactacg gctcccagtt cctcaactcg accctgcccg gcggggtgct cggcgacgtg       360
     gaccgggccg tccggcacgg ccggacggtc gaggacgtcg ggcgcggggc tcgggcggtc       420
     gccggtgaac gcgcggccgg cccgctggtg catgtcggcc tgaccgtgct ggtggtggcg       480
     ctggtgccgg ggccggcgct gtcctggttg ctgggcccgg tgatcctgct cggcgggctg       540
     ctgatcgtcg ccggtgcggt gctgctgatc gcgcggggga cgagccgttg gtcccggctg       600
     gccggcgtgg tggcggccga tctgcggacc ggtgtgttgg cccgggaggc ctggccccgg       660
     atcctgctcg cctcggtcgt cgtggctgtg ggtccggccg tgctgttcgt catcgcggcc       720
     cggctggtcg gcgtgccggc cggcgcgctg gagctggttc cggtggccat ggtcgtgctg       780
     gccgcgatgc tcgtgccgat caacgtgggc ggctgggggc cgcgagaatc ggtcgcggcg       840
     gccgtgttcg gggccgccgg ctggggtgcc gggaccggcg tcgcggcggc caccgcgttc       900
     ggcgcgctga ccctgatcgc caccaccccc gggctggtcg tcctgctcgc ccggcccctg       960
     tcccgatcga ccctggcccg atcgatccgg acccgatcgg ccgggcggac gcgggaggtc      1020
     ggcgatgagt ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page