(data stored in ACNUC30630 zone)

EMBL: CP001737.PE315

CP001737.PE315       Location/Qualifiers
FT   CDS_pept        357775..358188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76753"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Y2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76753.1"
FT                   /translation="MMDTNTMTSVGECFARAVAAKDRAGLRALLAESIDFQALTPGRHW
FT                   QAGAPDVVVDEIILGRWFGPGDVIEHLFSITGGQVADCERVTYRLGVRRDGHGYTVEQH
FT                   AYFTTVPAAGAGTRQIDWMRLLCAGYRSDPGVG"
     atgatggaca ccaacacgat gacctcggtc ggtgagtgct tcgcgcgggc cgtggcggcc        60
     aaggaccggg ccggcctgcg ggcgctgctg gccgaatcga tcgacttcca ggcgttgacc       120
     ccgggccggc actggcaggc cggcgccccg gacgtggtgg tcgacgagat catcctgggc       180
     cggtggttcg gtcccggtga cgtgatcgag cacctgttct cgatcaccgg cgggcaggtc       240
     gccgattgcg aacgggtcac ctaccggctc ggggtgcggc gggacggcca cggatacacg       300
     gtcgagcagc atgcctactt caccaccgtc ccggcggcgg gcgccggtac ccggcagatc       360
     gactggatgc ggttgctgtg tgccggttat cgctccgacc ccggcgtcgg ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page