(data stored in ACNUC30630 zone)

EMBL: CP001737.PE318

CP001737.PE318       Location/Qualifiers
FT   CDS_pept        361499..362044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0326"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: mxa:MXAN_5877
FT                   YceI-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76756"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Y5"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ACV76756.1"
FT                   /translation="MTAPARAVTPSAAMVGWWAVDPATSTARFRVRDKLVATARGTIAV
FT                   AGGTIRIGAAGDVVSARVELTTASIDTGNRHRDRDLRTERFLSADRHPTIVVQAAPAPA
FT                   RSDGWTVPAQLQARGSSVPVDLTVTLTAVDEGSAAVRITGRLDRSGLGIKVPGFVIARF
FT                   VDLEVDIRAHRLDHTPAD"
     atgaccgcgc cggcgcgggc ggtcacgccg agcgcggcga tggtcggatg gtgggccgtc        60
     gatccggcca ccagcaccgc gcgattccgg gtccgcgaca agctggtcgc gacggcccgg       120
     ggcacgatcg ccgtcgcggg cgggaccatc cggatcggtg ccgccggcga cgtcgtctcc       180
     gcccgggtgg aactgacgac cgcgtcgatc gacaccggga accgccaccg cgaccgggat       240
     ctgcgcaccg agcggttcct gtccgcggat cggcatccga cgatcgtggt gcaggcggct       300
     ccggcgccgg ccaggtccga cggatggacg gtgcccgccc agctgcaagc ccgagggagc       360
     tcggtgccgg tggacctgac ggtcacgctg acggcggtgg acgaggggtc ggccgccgtc       420
     cgcatcaccg gccggctgga ccggtccggc ctgggtatca aggtgcccgg tttcgtcatc       480
     gcccggttcg tcgatctgga ggtggacatc cgggcgcacc ggctcgatca caccccggca       540
     gactga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page