(data stored in ACNUC30630 zone)

EMBL: CP001737.PE322

CP001737.PE322       Location/Qualifiers
FT   CDS_pept        complement(365631..366998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0330"
FT                   /product="ferredoxin--NADP(+) reductase"
FT                   /note="KEGG: acp:A2cp1_3438 ferredoxin--NADP(+) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76760"
FT                   /db_xref="GOA:C8X5Y9"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Y9"
FT                   /inference="similar to AA sequence:KEGG:A2cp1_3438"
FT                   /protein_id="ACV76760.1"
FT                   /translation="MPNAVPDFAVAVVGAGPAGFYAAAALLAPPEPRVRVDMYERLPTP
FT                   WGLVRAGVAPDHPKIKSISAQFARTATHERFRWFGNVEVGTTVSREELLARYDAVVYCV
FT                   GSPADRDLHIPGADRPGSVGARDFVGWYNGHPDFRALTFDLQVSRAVIVGHGNVALDVA
FT                   RILSTPPDRLAATDIADHALVALRASRIRDVLVIGRRGPAQASFTTPELRELGELTGAD
FT                   VIVDPAQLGPPDADADLPHVPRHNLEVLRRYAAAEPAGTGRRITLRFLTSPIEIRGRDR
FT                   VESVVLGRNRLLDPGDGAATAIDTGEREELAAGLVLRAVGYRGVPIPGVPFDDRAGLVP
FT                   NVEGRVLGGDREYVAGWIKRGPSGIIGTNKKCATDTVHTLLADLASTPGASTRPAAADP
FT                   GAIEAWLRRRQPDLVDLDGWTAIDTAELRAGAPLGRPRVKVCTWRELLATARTVPV"
     gtgccgaacg ccgtgcccga cttcgcggtg gccgtcgtcg gcgccggacc ggccggcttc        60
     tacgccgccg cggccctgct ggccccaccc gagccgcggg tgcgggtgga catgtacgag       120
     cggctgccca ccccgtgggg cctggtccgc gcgggcgtcg ccccggacca tcccaagatc       180
     aaatccatct ccgcccagtt cgccagaacc gcgacgcacg aacggttccg gtggttcggc       240
     aacgtggagg tgggcaccac ggtcagccgc gaggagctgc tggcccgcta cgacgcggtg       300
     gtctactgcg tcgggtcacc ggccgaccgg gacctgcaca tccccggtgc ggatcggccg       360
     ggatcggtgg gcgcccgcga cttcgtcggc tggtacaacg gccatcccga tttccgggcg       420
     ttgaccttcg acctgcaggt cagccgggcg gtgatcgtcg gccacggcaa cgtcgccctg       480
     gatgtcgccc gcatcctgag caccccgccg gaccggctgg ccgccaccga catcgccgac       540
     cacgcgctgg tggcgttgcg ggccagccgc atccgggacg tgctggtgat cgggcgccgc       600
     gggccggcgc aggccagctt caccaccccc gagctgcgcg agctcggcga gctcaccggg       660
     gcggacgtga tcgtcgatcc ggcccagctg gggccgcccg acgccgatgc cgatctgcct       720
     catgtgcccc ggcacaacct ggaggtgttg cgccggtacg ccgcggccga gcccgccgga       780
     accggccgcc ggatcaccct gcgcttcctg acctcgccga tcgagatccg ggggcgggat       840
     cgggtggagt ccgtcgtgct gggccgcaac cggctcctgg atccgggtga cggggcggcg       900
     accgcgatcg acaccggtga gcgggaagag ctcgccgctg ggctggtgct gcgggcggtg       960
     ggctaccgcg gggtgccgat ccccggggtg ccgttcgacg accgcgccgg cctggtcccc      1020
     aacgtcgagg gccgggtgct cggcggcgac cgggagtatg tcgccggctg gatcaaacgg      1080
     ggtcccagcg ggatcatcgg aaccaacaag aagtgcgcca ccgacaccgt gcacaccctg      1140
     ctggccgacc tggccagcac cccgggcgcg tccacccggc cggccgccgc cgaccccggg      1200
     gcgatcgagg cgtggctgcg gcgacggcag ccggacctcg tcgatctcga cggctggacc      1260
     gcgatcgaca ctgccgagct gcgcgccggg gcacccctgg gccgcccgcg ggtcaaggtg      1320
     tgcacctggc gcgagttgct cgcgaccgcc cgaacggtcc cggtctga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page