(data stored in ACNUC30630 zone)

EMBL: CP001737.PE325

CP001737.PE325       Location/Qualifiers
FT   CDS_pept        complement(369189..369689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0333"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_2606 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76763"
FT                   /db_xref="GOA:C8X5Z2"
FT                   /db_xref="InterPro:IPR019099"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Z2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76763.1"
FT                   /translation="MGDNGSSSKATRIGLEILGWLLVAAGVAALILPGPGLLLLALGLW
FT                   VLAKNYEWADRLLDPVKRAAYRGAAEGVKSWPRIIMSTTLALGLIAVGVIWGIRPAAPG
FT                   WWPLAEKWWLFGGWGTGVFLIFSGLLALGLLGWSMKNFRYGTMTLDELYRDQKLNERPG
FT                   RRR"
     atgggcgaca acggcagttc ctcgaaggcg actcgcatcg ggctggagat cctgggctgg        60
     ctgttggtgg cggccggcgt cgccgcgttg atcctgcccg ggcccggcct gctgctgttg       120
     gccctgggcc tgtgggtgct ggccaagaac tacgaatggg ccgaccggct gctggacccg       180
     gtcaagcggg cggcctaccg gggcgccgcg gaaggcgtga agtcgtggcc gcggatcatc       240
     atgtcgacca cgctggcgct ggggctgatc gccgtcggcg tgatctgggg cattcgcccg       300
     gccgcgcccg gctggtggcc gctggccgag aagtggtggc tcttcggtgg ctggggcacc       360
     ggcgtgttcc tcatcttctc cgggctgctc gcgctcggac tgctcggctg gagcatgaag       420
     aacttccgct acggcaccat gacgctcgac gagctgtatc gcgatcagaa gctgaacgag       480
     cggccgggcc gtcgccgctg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page