(data stored in ACNUC30630 zone)

EMBL: CP001737.PE326

CP001737.PE326       Location/Qualifiers
FT   CDS_pept        complement(369779..370915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0334"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: pca:Pcar_0178
FT                   Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76764"
FT                   /db_xref="GOA:C8X5Z3"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Z3"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACV76764.1"
FT                   /translation="MSESSLWSLLLVMTVAALAPIASRLVPGRPPQVLFLILGGMVIGP
FT                   SVLGWADAVDIELLSGLGLGFLFLLAGHELDPRMLRERAGTQALLAWGVSAALAVLVVG
FT                   GLEYLGYVKAFVPVAIALTTTALGTLLPILREQQMLAGPFGRYVFAAGAVGELLPILAI
FT                   SLFLGAYDSWWEALIIASIAGLALLLAWLHKHATSQSTLRITVVLLLALLLITENFGIE
FT                   AALGAFFAGMVLRQTSSAEGNQEFEDKLDAVGYGFFIPVFFVSSGMGLDLQSILNSPGR
FT                   LLAFFVLLLVVRGVPAILIYRKTLGPRQRVEMMFLTATALPLLVALSEIGLQSGVMLPE
FT                   NAAALVGAGVLSIAIFPFVAARLHRPVGQRPVRDPRVP"
     atgagcgaga gctcgctgtg gtcgctgttg ctggtgatga ccgtggccgc gctggcccct        60
     atcgcctccc ggctggtgcc gggccggccg ccccaggtgc tgttcctgat cctgggcggc       120
     atggtcatcg ggccctcggt gctgggctgg gcggacgccg tcgacatcga actgctctcc       180
     gggttggggc tgggctttct gttcctgctg gccggccacg agctggaccc acggatgctg       240
     cgcgagcggg ccggcacgca ggccttgctg gcctggggcg tcagcgcggc gctggcggtg       300
     ctggtcgtcg gcgggctgga gtacctcggc tacgtcaagg ctttcgtccc ggtggcgatc       360
     gccctgacca ccaccgcact gggcacgctg ctgccgatcc tgcgcgagca gcagatgctc       420
     gccgggccgt tcggacggta cgtcttcgcg gccggggcgg tcggcgagtt gctgcccatc       480
     ctggcgatct cactgtttct cggcgcctac gactcctggt gggaggcgtt gatcatcgcc       540
     tcgatcgccg gcctggccct gctcctggcc tggctgcaca agcacgccac ctcgcagtcg       600
     acactgcgga tcaccgtggt cctgctgctg gccctgttgt tgatcaccga gaacttcggc       660
     atcgaggcgg ccctgggcgc gttcttcgcc ggcatggtgt tgcggcagac ctcgtccgcc       720
     gagggcaatc aggaattcga ggacaagctc gatgccgtcg gctacggctt cttcattccc       780
     gtcttcttcg tcagctcggg catgggcctt gacctgcagt cgatcctgaa cagccccgga       840
     cggttgctgg ccttcttcgt gctgctgttg gtggtgcggg gggtgccggc catcctgatc       900
     taccgcaaga ccctgggccc gcggcagcgc gtagagatga tgttcctgac ggcgacggca       960
     ttgccgttgc tggtcgccct gtccgagatc ggcctgcagt cgggggtgat gctgccggag      1020
     aacgcggccg ccctggtcgg cgccggtgtc ctgtcgatcg caatcttccc gtttgtcgcg      1080
     gctcgtctgc atcgcccggt cggccaaaga ccggtccgcg accctcgtgt gccctga         1137
//

If you have problems or comments...

PBIL Back to PBIL home page