(data stored in ACNUC30630 zone)

EMBL: CP001737.PE328

CP001737.PE328       Location/Qualifiers
FT   CDS_pept        complement(372611..373441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0336"
FT                   /product="ANTAR domain protein with unknown sensor"
FT                   /note="PFAM: ANTAR domain protein; KEGG: xcv:XCV2090
FT                   response regulator NasT"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76766"
FT                   /db_xref="GOA:C8X5Z5"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Z5"
FT                   /inference="protein motif:PFAM:PF03861"
FT                   /protein_id="ACV76766.1"
FT                   /translation="MAQGRRELPPALTAAALADLLRDAITRPLAEAAPSLMDLALTGPW
FT                   QGAALAGRLASGAWGTLSETGSVDPGCDQRQWALQDGPAHDALTVDLIIAGDLGRDPRW
FT                   PRWRPAALTLGVRAAASIRLHAGRTLGTLTLYSPTPLPPAPLSSGRPRAMDGVVDEWAD
FT                   LATLAAHLSVLVEGSERRQQLERALVSRSTVGQAVGLLRSRFGLDADQGFALLRRHSQQ
FT                   RNVKLIELARAVVATGELPGLDREPDPNRQSRFRAGTAGDCAVREPAHPGQWRS"
     atggctcagg gtcggcgcga actgccgcct gccctgactg cggccgccct cgccgacctc        60
     ctgcgggacg cgatcacccg gccgctggcc gaggcggccc catcgctcat ggatctcgca       120
     ttgaccggcc cgtggcaggg cgccgcgctg gccggccgtc tcgcctccgg agcctgggga       180
     acgctgagcg agaccgggtc ggtcgacccg ggctgcgacc agcggcagtg ggcgctgcag       240
     gacggcccgg cccacgacgc gctgaccgtt gatctgatca tcgccggcga tctgggccgc       300
     gacccgcgct ggccccggtg gcgcccggcg gcgctcacgc tcggcgtccg ggccgccgcc       360
     tccatccgcc tgcacgccgg acggacgctg ggcacgctca ccctgtactc ccccaccccg       420
     ctgccgcccg ccccgctctc gtccgggcgg ccccgggcca tggacggcgt cgtcgacgag       480
     tgggcggatc tggccaccct tgcggcccac ctgtcggtgc tggtcgaggg gtccgagcgg       540
     cggcagcaac tggaacgtgc gctggtgagc cgcagcacgg tcgggcaggc ggtcggcctg       600
     ctgcgcagcc ggttcggcct ggacgccgat cagggcttcg ccctgttgcg ccggcactcg       660
     cagcaacgca acgtcaagtt gatcgagctc gcgcgggccg tggtggccac cggcgagttg       720
     cccgggctgg accgggagcc ggacccgaat cgacaaagcc gtttccgagc gggcacggcg       780
     ggggactgtg cagttcggga gcccgctcac ccgggacagt ggcgctccta a                831
//

If you have problems or comments...

PBIL Back to PBIL home page