(data stored in ACNUC30630 zone)

EMBL: CP001737.PE333

CP001737.PE333       Location/Qualifiers
FT   CDS_pept        375046..375570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmj:BMULJ_04674 bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76771"
FT                   /db_xref="UniProtKB/TrEMBL:C8X600"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76771.1"
FT                   /translation="MILPPVRDPRFITIRRGGTLTDTDHHLLALWAASCAEHVLALFET
FT                   VRPDDPRPRVAIEHARAWVRGEVTMMQSRAAGGHAMGAARDLRGPARHAAYAAGQAGVV
FT                   AHVAAHELGAAAYAIKAVRAAAGGDRVAAAQAAGRRECQWQRDQLPDAIRALVLDDQRL
FT                   RNDICWSVFEV"
     atgatcctgc ccccggttcg cgatccacgc ttcatcacca tccgtcgcgg cggcaccctg        60
     accgataccg atcaccacct gctggcgctg tgggccgcat cctgcgccga gcacgtgctg       120
     gccctgttcg agaccgtgcg gccggacgat ccgcgcccgc gtgtggccat cgagcacgcc       180
     cgggcctggg tccggggtga ggtcacgatg atgcagtcgc gggccgccgg cggccacgcc       240
     atgggcgccg cccgtgatct gcgagggccg gcccggcacg ccgcctacgc cgccggccag       300
     gccggggtgg tcgcgcacgt cgccgcacac gaactcggcg ccgccgccta cgcgatcaag       360
     gcggtccgcg cggcggccgg tggggatcgg gtcgccgcgg cgcaggcggc cggtcgtcgc       420
     gagtgccagt ggcagcgcga ccagctcccg gacgcgatcc gcgcgttggt gctggacgac       480
     cagcggctgc gcaatgacat ttgctggtcg gtcttcgagg tctga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page