(data stored in ACNUC30630 zone)

EMBL: CP001737.PE337

CP001737.PE337       Location/Qualifiers
FT   CDS_pept        380206..380817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0345"
FT                   /product="DNA-binding SAP domain protein"
FT                   /note="SMART: DNA-binding SAP domain protein; KEGG: FAP208;
FT                   flagella associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76775"
FT                   /db_xref="GOA:C8X604"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="UniProtKB/TrEMBL:C8X604"
FT                   /inference="protein motif:SMART:SM00513"
FT                   /protein_id="ACV76775.1"
FT                   /translation="MTITSTEPYTAATTAARQATERGVDAFKKGAKSLTEQTTNAAASL
FT                   PTVDLTKPVARYFDYIQKSIDLNREFATRWAELVTSFSGLVREQAETAGHVVREQTDAV
FT                   ADLTVEQAAKADELAREQAEKAEQVQREQAEQAEQAKRDEEKAAKAAERAEAKRAKEQA
FT                   REPYEGLTKAELADKLAERDLPKSGTVEELIERLVDADNQ"
     atgacgatca ccagcaccga gccttacacc gccgccacca ccgcagcccg ccaggccacc        60
     gagcggggcg tcgacgcctt caagaagggt gcgaagtccc tgaccgagca gaccacgaat       120
     gcggcggcga gcctgcccac cgtcgacctg accaagccgg tcgctcggta cttcgactac       180
     atccagaagt cgatcgacct caaccgcgag ttcgccaccc gttgggccga gctggtcacc       240
     tcgttctccg gcctggttcg ggagcaggct gagacggccg gtcacgtggt gcgggagcag       300
     accgacgcgg tcgccgatct gaccgtggag caggccgcca aggccgacga gctggcgcgt       360
     gagcaggccg agaaggccga gcaggtccag cgcgagcagg ccgagcaggc cgagcaggcc       420
     aagcgcgatg aggagaaggc ggccaaggcc gccgagcgcg cggaggccaa gcgggccaag       480
     gagcaggcgc gcgagccgta cgagggcctg accaaggccg agctggccga caagctggcc       540
     gagcgggatc tgcccaagtc cggcaccgtg gaggagctca tcgagcgcct cgtcgacgcc       600
     gacaaccagt aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page