(data stored in ACNUC30630 zone)

EMBL: CP001737.PE344

CP001737.PE344       Location/Qualifiers
FT   CDS_pept        386034..386549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0352"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afr:AFE_2556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76782"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:C8X611"
FT                   /inference="similar to AA sequence:KEGG:AFE_2556"
FT                   /protein_id="ACV76782.1"
FT                   /translation="MTDVVDTAAAIVPQFDTEASGRKLAIICSKGTLDMAYPGLVLANA
FT                   ALGEGIETHLFFTFWGFEMINKKTMDHLQFTVLGNPATHLPQGLGGLPWMTAMATSKMK
FT                   KSIAEVGVPEVPDFLDQIVASGGHLWACRMSADMNHLTKDDLYDEVEGIISASDFIEMT
FT                   EGAQLLFI"
     atgaccgacg tcgtcgacac cgccgccgcg atcgtcccgc agttcgacac cgaggcaagc        60
     gggcgcaagc tcgccatcat ctgttccaag ggcacgctgg acatggccta tccgggtctg       120
     gtcctggcca acgccgcgtt gggcgaaggc atcgaaaccc atttgttctt caccttctgg       180
     ggtttcgaga tgatcaacaa gaagaccatg gaccacctgc agttcaccgt gctgggcaac       240
     cccgcgaccc acctgccgca ggggctcggc gggttgccgt ggatgacggc gatggccacc       300
     tcgaagatga agaagtcgat cgccgaggtc ggcgttcccg aggtgccgga cttcctcgac       360
     cagatcgtcg cgtccggtgg tcatctgtgg gcctgccgca tgtcggcgga catgaaccac       420
     ctgaccaagg acgacctgta cgacgaggtc gaaggcatca tcagcgcatc ggacttcatc       480
     gagatgaccg agggcgccca gttgctgttc atctga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page