(data stored in ACNUC30630 zone)

EMBL: CP001737.PE348

CP001737.PE348       Location/Qualifiers
FT   CDS_pept        complement(388623..388889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0356"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   lch:Lcho_3746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76786"
FT                   /db_xref="GOA:C8X615"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C8X615"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ACV76786.1"
FT                   /translation="MVQIEPESITAVVNRLRRAQGQIGGVLRMIEEGRDCQDIVTQLAA
FT                   VSRAVDRAGFAVIAAGLKQCLIESDGADTLDTKTMEKLFLSLA"
     atggtccaga tcgaaccgga atcaatcacc gccgtcgtca accggctgcg ccgggcccag        60
     gggcagatcg gcggggtgct gcggatgatc gaggagggcc gcgactgcca ggacatcgtg       120
     acccagctcg ccgcggtcag ccgggccgtg gaccgcgccg ggttcgccgt catcgcggcc       180
     ggcctcaagc agtgcctcat cgagtccgac ggtgcggaca ccctggacac caagaccatg       240
     gagaaactgt tcctgtccct ggcctga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page