(data stored in ACNUC30630 zone)

EMBL: CP001737.PE350

CP001737.PE350       Location/Qualifiers
FT   CDS_pept        complement(389362..389733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0358"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: mxa:MXAN_5670 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76788"
FT                   /db_xref="GOA:C8X617"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C8X617"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ACV76788.1"
FT                   /translation="MATTTLTDSTFERVVQRDGIVLIDFWASWCGPCRMFAPVFEQAAT
FT                   ANPDIVFGKVDTEAEPNLASAAGIRSIPTLMVFRDGILVFSQPGALPAKSLDQLITAVR
FT                   GLDMDQVRAQVAAAKAMSA"
     atggccacca ccacactgac cgacagcacg ttcgaacgcg tcgtgcagcg cgacgggatc        60
     gtcctgatcg acttctgggc ctcctggtgc gggccgtgcc ggatgttcgc acccgtcttc       120
     gagcaggccg cgacggccaa cccggacatc gtgttcggca aggtcgacac cgaagccgaa       180
     ccgaatctgg cctcggcggc cggtatccga tccattccga cgctgatggt gttccgggac       240
     ggcatcctgg tcttctccca gcccggcgcc ctgccggcga agtccctcga ccaactcatc       300
     acggccgtgc gaggcctgga catggaccag gtccgggccc aggtcgccgc ggccaaggcg       360
     atgtcggcat ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page