(data stored in ACNUC30630 zone)

EMBL: CP001737.PE354

CP001737.PE354       Location/Qualifiers
FT   CDS_pept        393764..395257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0363"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: tbd:Tbd_1700
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76792"
FT                   /db_xref="GOA:C8X621"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C8X621"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACV76792.1"
FT                   /translation="MGLTRPSGPAATPGSASAGRTRPTGRPSVTADIGPGVLLDERYRL
FT                   DERVGAGGTATVYRGTDTVLHRQVAVKLFRPDGADATVARRRAREMRLAAAVSDPHLVT
FT                   VYDAHPADPVPTTPEAALWYLVTEYVDGPTLADNVAGGPVAPEQLRSVGAGLARALAAL
FT                   HDHGLVHRDVKPGNILITSSGQPKLTDLGIAVEVGGLPVTQDGMVVGTVPYLSPEQAQG
FT                   DDVGPASDVYSLGLVLLECLNGHREFPGAPLESAVARLLRDPAVPPDLPPPWPDLLAAM
FT                   TDRDPTRRPSAAQVAATLAADPTDVTPIAQAERPPTTVVLTRPAVRAEPAKPRRRRWAV
FT                   LATAVVAAAILGGWWVVGADDPAVAPPTTEAPTSASPPAAPPTPTATAPQPAADPATSA
FT                   ESTTTAAPPTSAAASSSSEPIVDDARTVAPPEPDPIDAPEQVTTAATAGNGNGGNNGNG
FT                   NGNGNGNGNGNNGNGNGGGNNGNGNGNGGGNSGNGNGRG"
     atgggattga cgcggccgtc cgggcccgcg gcgacgcccg ggtctgcgag cgccgggaga        60
     accaggccga ccggccggcc gtcggtgacg gctgacatcg gccccggcgt gctgctcgat       120
     gagcgctacc ggctggacga acgcgtcggc gcgggcggca ccgccaccgt ctaccgcggc       180
     acggacaccg tgctgcaccg gcaagtggcc gtgaaactgt tccgtccgga cggcgcggac       240
     gccacggtcg cccggcgccg cgcccgggag atgcggctgg ccgcggcggt aagcgatccg       300
     cacctggtga cggtttacga cgcgcacccc gcggatccgg tgcccaccac cccggaggcc       360
     gcgctgtggt acctggtcac cgagtacgtc gacggtccca ccctggccga caatgtcgcc       420
     ggcgggccgg tggcgcccga gcagctgcgc agcgtcggcg ccggcctcgc gcgggcgttg       480
     gcggcgctgc acgaccatgg actggtgcac cgggacgtca agcccgggaa cattctgatc       540
     acctcgtccg ggcagcccaa gctcaccgac ctgggcatcg cggtcgaggt gggtggcctg       600
     ccggtgaccc aggacgggat ggtggtgggc acggtcccgt acctgagccc ggagcaggct       660
     caaggcgacg acgtcggccc ggcgtcggac gtgtactcgc tcggcctagt gctgctcgaa       720
     tgcctgaacg gccaccggga gttccccggt gccccgctgg agtccgcggt ggccaggttg       780
     ctccgcgatc ccgctgttcc gcccgatctg ccgccgccgt ggcccgacct gcttgccgcg       840
     atgaccgatc gcgatccgac ccgccgacct tcggcggccc aggtcgccgc gaccctggcc       900
     gcagacccga ccgacgtcac gccaattgct caggcggagc ggccgccgac cacggtcgtg       960
     ctgacccggc cggccgtccg ggccgagccg gcgaagccac gccgccgccg gtgggccgtc      1020
     ctggccaccg ccgtggtcgc ggcggccatc ctcggtggct ggtgggtcgt cggtgccgac      1080
     gatccggccg tcgctccgcc gacgaccgag gccccgacca gcgcgtcgcc gcccgccgcg      1140
     ccgccgacgc ccaccgccac ggccccgcag ccggccgccg atccggccac gtcggccgaa      1200
     tcgacgacca cagcggcgcc acctactagc gcggcggcga gttcgtcgag cgagccgatc      1260
     gttgacgatg cgcgcacggt ggcgcccccg gaaccggatc cgatcgatgc ccccgaacag      1320
     gtgacgaccg cagccaccgc cggcaacgga aatggcggga acaacggcaa tggcaatggc      1380
     aatggcaatg gcaacggcaa tggcaacaac ggcaatggca acggcggcgg gaacaacggc      1440
     aacggcaacg gcaatggagg tggcaacagc ggaaatggca acgggcgcgg gtag            1494
//

If you have problems or comments...

PBIL Back to PBIL home page