(data stored in ACNUC30630 zone)

EMBL: CP001737.PE355

CP001737.PE355       Location/Qualifiers
FT   CDS_pept        complement(395289..397586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0364"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0002212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76793"
FT                   /db_xref="GOA:C8X622"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C8X622"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0002212"
FT                   /protein_id="ACV76793.1"
FT                   /translation="MRDILGVDRNYASLSTKDLLDARDQYHWHLVHRRNVIGTAVGLYH
FT                   IRKDEDWPSRERSARAVAAAARAASTRMRRTSGGIGPEPRTFENSEVRDYSWPCVLVLV
FT                   HTWIDADQFGTDDGQLPPEDMIPTTLYLPDGRTVPVCVIQVEPTVPDRDLLPAWTWPKS
FT                   VIGGGFPLISHTQGTTNVASVGALVTDGHTVYALTSRHVAGPAGQPIGTILRGQAVDVG
FT                   RSSERQLTRLPFTQVYPDFPAHRTYLTLDAALVEVNDLADWTSQTYGLPPVGALADLSE
FT                   RNIGMQLINAQVTAYGAASGRLTGRIAALFYRHRSMGGYDEITDFLIAPDPGQPSSQPG
FT                   DSGTVWHLIEPSEQPDDPARRLRPIALQWGGQGVRPADPGPGYNFALAAGLTAILRLLD
FT                   VELVVDYNTGPQPFWGKTGHYTLATVACAQVVTPTLRTLMAANQDRISFPAAGLSPGDI
FT                   DQATKDAKQHGGFVPLADVADVIWKNLAGQVRGGRDTSPRTGPEHPTHYADIDEPRPAD
FT                   HLTLRALCMQDPANVAVGVWQAFYDALGEQASRDRGLLPFRVWQFYDAMLDALAQDDLV
FT                   RYLAAAGLMAHYVGDACQPLHGSTLADGLPDGTGKGVHSAYESAMIDHHAADILAALLG
FT                   RLQDLAAHPLPPVASGQQAAVATVALMDRTATAIPPVDLVNAYAATPGGQSKAVTGKLW
FT                   DRFGPATVSVLADGARTLAMLWDSAWTQGQGDTRFTAAQLTAVDRSALQHLYESPGFVP
FT                   SLDLDTIGPNLH"
     atgcgcgaca tcctgggagt cgaccggaat tacgcgagcc tgtccaccaa ggatctgctg        60
     gacgcgcggg atcagtacca ctggcatctg gtccaccgcc gcaatgtgat cggcaccgcg       120
     gtcgggctgt accacattcg caaggacgag gactggccgt cgcgggagcg gtcggcgcgg       180
     gcggtggcgg ccgcggcccg cgcggccagc acccggatgc gacggacgtc cggcgggatc       240
     ggtcccgagc cacgtacttt cgagaactcc gaggtccgcg actactcctg gccgtgcgtg       300
     ctcgtgctgg tgcacacgtg gatcgacgcc gaccagttcg gcactgacga cgggcagctg       360
     ccgccggagg acatgattcc cacgacgctg tacctgcccg acgggcgcac ggtgccggtc       420
     tgcgtcatcc aggtcgagcc caccgtcccc gaccgcgacc tgctgccggc ctggacctgg       480
     ccgaaatcgg tgatcggcgg cgggtttccg ctgatcagcc acacccaggg aacgaccaac       540
     gtggccagcg tcggcgccct ggtcaccgat gggcacacgg tgtacgcgct gaccagccgg       600
     catgtcgccg ggcccgccgg ccagccgatc ggcaccatcc tgcgcggcca ggccgtggac       660
     gtcggccgat cgagcgagcg gcagctgacc cggctgccgt tcacccaggt ctaccccgac       720
     ttcccggccc atcgcaccta tctgaccctg gatgccgcgc tggtcgaggt gaacgacctg       780
     gccgactgga cctcgcagac gtacgggctg cccccggtcg gcgcgttggc cgacctcagt       840
     gaacgcaaca tcggcatgca gttgatcaac gcccaggtca ccgcgtacgg cgccgcgtcc       900
     ggtcggttga ccggccggat cgccgccctg ttctaccggc atcgcagcat gggcggctac       960
     gacgagatca ccgacttcct gatcgccccc gaccccgggc aacccagctc gcagcccgga      1020
     gactccggca ccgtgtggca cctgatcgaa ccgtccgagc agccggacga cccggcccgg      1080
     cggctgcgac cgatcgcgct gcagtggggt gggcagggag tgcgaccggc cgacccgggt      1140
     cccggctaca acttcgccct cgccgccggt ctgaccgcca tcctgcggtt actggacgtg      1200
     gagctggtcg tcgactacaa caccggccca caaccgttct ggggcaagac cggtcactac      1260
     accctggcta ccgtggcctg cgctcaggtg gtcacgccga ccctgcgcac cctgatggcc      1320
     gccaaccagg atcggatcag tttcccggcc gccgggttgt cgcccggtga catcgaccag      1380
     gccaccaagg acgccaagca gcacggcggt ttcgtgccgc tggccgacgt cgccgacgtc      1440
     atctggaaga acctagcggg tcaggtccgc ggcggccggg acacctcgcc gcggaccggt      1500
     cccgaacacc cgacccacta cgccgacatc gacgagccgc gtccggccga ccacctcacc      1560
     ctgcgagcgc tgtgcatgca ggacccggcc aacgtcgccg tcggcgtctg gcaggcgttc      1620
     tacgacgccc tgggcgagca ggcgtcgcgt gaccggggcc tgctgccgtt ccgggtctgg      1680
     cagttctacg acgcgatgct cgatgcgctc gcccaggacg acctggtccg gtacctggcg      1740
     gcggccgggc tgatggccca ctacgtcggt gacgcctgcc agccgctgca cggctcgacg      1800
     ctggccgacg gcctgcccga tggcaccggc aagggcgtgc actcggcgta cgagagcgcc      1860
     atgatcgacc accacgccgc cgacatcctg gccgcgctcc tcggccggct ccaggacctg      1920
     gccgcccatc ccttgccgcc ggtcgccagt gggcagcagg ccgcggtggc caccgtcgcg      1980
     ctgatggacc gcaccgcgac cgccatccca cccgtggacc tggtcaacgc ctacgccgcc      2040
     accccgggcg gccagtccaa ggccgtcacc ggcaagctct gggatcgatt cggaccggcc      2100
     accgtcagcg tgctggccga cggcgcgcgc accctggcga tgctctggga cagcgcctgg      2160
     acccagggcc agggcgacac ccgtttcacc gcagcccaac tcaccgcggt cgaccggtca      2220
     gcgctgcaac acctctacga gagcccgggc ttcgtgccct ccctcgacct ggacaccatc      2280
     ggacccaacc tgcactga                                                    2298
//

If you have problems or comments...

PBIL Back to PBIL home page