(data stored in ACNUC30630 zone)

EMBL: CP001737.PE359

CP001737.PE359       Location/Qualifiers
FT   CDS_pept        complement(401851..402540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76797"
FT                   /db_xref="GOA:C8X626"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:C8X626"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76797.1"
FT                   /translation="MVHETSIDAVPDVRSPTARSTRQLISVSDNLDPVRVQAQLDLAAT
FT                   VLGLGRCIDEIVIPVRRQLRMMVATGERDHLQELIATETIRAWLDRCGWSLPAPHPIGT
FT                   VLLACGPRDCDMVGPESLALLLRGHRRPCWVLGARIPTRMLATAARAADTSAVVVFAHH
FT                   RRGRPQAIASLEAVDALAIPVYYAGEAFDADRGRPDCPGRYLGTGLQQAAEMLMAATSP
FT                   PNRAGSS"
     gtggtccacg agacgtcgat cgacgcggtc ccggatgtcc ggtcccccac cgcgcggtcg        60
     acccgtcagc tcatcagcgt gtccgacaac ctcgatcccg tccgcgtcca agcccaactc       120
     gacctcgcgg caacggttct cggactcggc cggtgcatcg acgagatcgt gatcccggtc       180
     cggcggcaac tacggatgat ggtggcgacc ggagaacgcg atcacctcca ggaactgatc       240
     gccaccgaga ccatccgagc gtggttggac cgatgcggct ggtcgcttcc ggcgccgcac       300
     cccatcggga cggttctgct cgcctgcggg ccccgcgact gcgacatggt cggtccggaa       360
     tccctggcgc tgctgctgcg gggccatcgc cgaccctgct gggtgctcgg cgcccgcatc       420
     ccgacgcgca tgctcgccac cgcggcacgg gccgccgaca ccagcgcagt ggtggtcttc       480
     gcgcaccacc gtcgaggccg gccccaggcg atcgcttcgc tcgaagccgt tgacgccctg       540
     gccattccgg tctactacgc cggagaggcg ttcgatgctg atcgcggccg gccggactgc       600
     cccggccgct accttggcac cggcctgcag caggccgccg agatgctcat ggccgcgacg       660
     tccccaccga accgggccgg ctcgagctga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page