(data stored in ACNUC30630 zone)

EMBL: CP001737.PE369

CP001737.PE369       Location/Qualifiers
FT   CDS_pept        414666..415073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76807"
FT                   /db_xref="UniProtKB/TrEMBL:C8X636"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76807.1"
FT                   /translation="MGNITDIPRPAVLDPHRPLRRHGTELFADNRPEAEVLRQALEDSC
FT                   AYADQLWQTLNYLREYLMLSLPPESTATGAGRMGASPYGPDDDEGWQAWMQAFAATTSV
FT                   LCGPNGDGGFGFSRARLEAQHRGFHPHSGQG"
     atgggcaaca tcaccgacat cccgcgaccg gcggtgctcg acccgcaccg gccactgcgc        60
     cggcatggaa ccgagctctt cgccgacaac cgacccgagg cggaggtgct gcgccaggcg       120
     ctcgaggatt cgtgcgccta cgcggaccaa ctgtggcaga cgctcaatta cctacgcgag       180
     tacctgatgc tcagcttgcc gcccgaatcg acggcgacgg gagccggccg gatgggggcc       240
     agcccgtatg gtccggacga cgacgaagga tggcaagcct ggatgcaggc attcgctgcg       300
     acgacatcgg tcctgtgtgg gcccaacggc gacggcggtt tcgggttcag ccgagcccgt       360
     ctggaagcgc agcatcgagg atttcacccg cactccggtc aggggtga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page