(data stored in ACNUC30630 zone)

EMBL: CP001737.PE372

CP001737.PE372       Location/Qualifiers
FT   CDS_pept        complement(417308..417640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76810"
FT                   /db_xref="GOA:C8X639"
FT                   /db_xref="UniProtKB/TrEMBL:C8X639"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76810.1"
FT                   /translation="MWAAATAAVGVAAILRSEPVARLVAGRGTAPDARLVRILGARQLV
FT                   QGGATLIRPTRHLVAIGGGVDVIHGASMVLAAVIWPEHRTAALISAGVAGTSAAAAALI
FT                   LVGDHR"
     atgtgggcgg ccgccaccgc tgccgtggga gtggccgcga tcctgcggtc ggagccggtt        60
     gcgcggctgg tcgccggccg cggcaccgcc ccggatgcgc ggctggtccg gatcctcggc       120
     gcccgccagc tggttcaggg tggcgcgacg ttgatccgtc ccacccggca cctggtcgcg       180
     atcggcggcg gggtcgatgt catccacgga gccagcatgg ttctggccgc tgtgatctgg       240
     ccagagcacc ggaccgcggc cctgatcagc gccggggtcg ccggcacgtc ggccgccgcc       300
     gcggccctca tcctggtcgg cgatcatcga tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page