(data stored in ACNUC30630 zone)

EMBL: CP001737.PE377

CP001737.PE377       Location/Qualifiers
FT   CDS_pept        complement(422565..423656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0389"
FT                   /product="glycoside hydrolase family 76"
FT                   /note="PFAM: glycoside hydrolase family 76; KEGG: glycosyl
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76815"
FT                   /db_xref="GOA:C8X644"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:C8X644"
FT                   /inference="protein motif:PFAM:PF03663"
FT                   /protein_id="ACV76815.1"
FT                   /translation="MRPGRAARMLAVLVAGSLLVGCGAQAPSDQPAVDALVQMYDQRSG
FT                   VWPTTGWWNSANAVNALTNYMIVSGDHRYTWVLENTFAKKRNAARGNFINDFTDDTGWW
FT                   ALAWISAYDLTGNAEYLQTARRAVDFMWSNQDDTCGGGLWWTVNHGYKNAISNELFIQA
FT                   AAELATRLGDAGAAYLDRARTVWDWLQASGMINDDLLVNDGLNAATCRNNRDTTWTYNQ
FT                   GVILGGLVALFRATGDHSYLKSARELADASTRAPGLHVDGVLTEPCERTGCDVNGPSFK
FT                   GIYVRNLGELNRVLDDHPYSDYLIDQASTAYDHNRTDDNEYGLHWAGPVDRVNGATQQS
FT                   AVDLLVAAQPIPETPESAVSTSG"
     atgcgccccg gtcgagccgc gagaatgctg gccgtgctag tggccggctc gctgctggtc        60
     ggctgcggcg ctcaggcccc ctcggaccag cccgccgtcg atgccctggt ccagatgtac       120
     gaccagcgct ccggggtgtg gcccaccacc gggtggtgga acagcgcgaa cgcggtgaac       180
     gcgttgacca actacatgat cgtctcgggc gatcaccgct acacctgggt cctggagaac       240
     accttcgcca agaagcgcaa cgccgcgcgc ggcaacttca tcaacgattt caccgacgac       300
     accggttggt gggccctggc ctggataagc gcgtacgacc tgaccgggaa cgccgagtac       360
     ctacagaccg cgcggcgcgc cgtggacttc atgtggagca atcaggacga cacgtgcggc       420
     ggcggtttgt ggtggacggt gaatcacggc tacaagaatg cgatctccaa cgagctgttc       480
     atccaggccg cggccgagct ggcgacgcgt ctgggcgatg cgggcgcggc gtacctcgac       540
     cgggcccgca ccgtctggga ctggctccag gcatccggga tgatcaacga cgacctgctg       600
     gtcaacgacg ggctcaatgc cgccacctgc cgcaacaatc gggacaccac ctggacctac       660
     aaccagggcg tgatcctggg cggtttggtc gcgctgttcc gggccaccgg cgaccactcg       720
     tacctgaagt cggcccgcga actggccgac gcctccaccc gggctcccgg gctgcacgtc       780
     gacggcgtgc tcaccgaacc ctgcgagcga accggctgtg acgtgaacgg tcccagcttc       840
     aagggcatct acgtccgcaa cctcggcgaa ctcaaccgcg tcctggacga ccacccctac       900
     agcgactacc tgatcgacca ggcgtcgacc gcctacgacc acaaccgcac cgacgacaac       960
     gagtacggct tgcactgggc cgggccggtt gatcgcgtca acggggcaac ccaacagagc      1020
     gcggtcgacc tgctggtcgc cgcccaaccg atcccggaga cccccgagag cgccgtcagc      1080
     acgtcgggat aa                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page