(data stored in ACNUC30630 zone)

EMBL: CP001737.PE380

CP001737.PE380       Location/Qualifiers
FT   CDS_pept        complement(425945..427303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0392"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpt:Rpal_3822 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76818"
FT                   /db_xref="GOA:C8X647"
FT                   /db_xref="InterPro:IPR018723"
FT                   /db_xref="UniProtKB/TrEMBL:C8X647"
FT                   /inference="similar to AA sequence:KEGG:Rpal_3822"
FT                   /protein_id="ACV76818.1"
FT                   /translation="MPTPSQGGWSVLRDAVRTQLWPIPAVGIGLAVFLGVLLPQLDAQI
FT                   DDGLPSAVTDYLFGGGAEAARAVLEAVAGSLITVTSLTFSLTVVTLQLASSQFSPRLLR
FT                   TFSSDRFVQITLGVFLGTFTYALTVLRTVRTAADDQELFVPQIAVTVAFLLAVASVFAL
FT                   VIFLAHLAKEIRVETMLATVHRDATATLRRVLPDRQADRPPATAPDIPAVSEVVPAPSS
FT                   GFLVWIDELAVLRAARQGDAILTITAPPGSSLIQGVPMGECWPRRGAEFDPDVLRELRD
FT                   AIAPAIHTGPERTAAQDVAFGLRQLTDVTVKALSPGINDPTTAIHALGHASALLTELVG
FT                   RDLGPRVLADDDGPTRVILQRPGFAELLDLAVAQPRRYGAGDPAVLDRLFQLLREVAWL
FT                   VTDPIEQRSIAEQLARLRATTEAQSFDVAEQKMLKRTADEVIPALGGRWRHRS"
     gtgccaacac cgagccaagg aggctggagc gtccttcgcg acgccgtccg cacccaactc        60
     tggccgattc ccgcggtcgg catcggactc gcggtgttcc tcggagtgct gctcccgcag       120
     ctggatgccc agatcgacga cggcctgccg tcggcagtga ccgactacct attcggtggc       180
     ggagccgagg cggcccgagc ggtcctggag gccgttgccg gatccctgat cacggtcacc       240
     tcactgactt tctcgctgac cgtggtgacc ctccaactgg ccagcagcca gttctcaccg       300
     cggctcctgc gcaccttcag tagcgaccga ttcgtacaga tcacccttgg cgtgttcctg       360
     ggcacgttca cctacgcgtt gaccgtgctg cgcaccgtgc gcacggcagc tgacgaccag       420
     gagctgttcg ttccgcagat cgcagtgact gtggccttcc tgctcgccgt ggccagcgtg       480
     ttcgctctgg tgatcttcct ggcccacctg gccaaagaga tccgggtcga aacgatgctg       540
     gcgaccgtgc accgggacgc caccgcaact cttcgccggg ttctgccgga ccgtcaagcg       600
     gatcggccac cggcgaccgc tcccgacatc cctgcggtca gcgaggtcgt gccggccccg       660
     tcctccggct tcctggtctg gatcgacgag cttgcggtgt tgcgggctgc ccggcagggt       720
     gatgcgattc tgacgatcac cgcaccgccc ggcagctccc tgatccaagg tgtgccgatg       780
     ggggagtgct ggcctcgtcg gggcgccgag ttcgacccgg acgtcctgcg cgagctgcgg       840
     gacgcgatcg ctccggccat ccatacggga ccagaacgca ccgccgccca agacgtcgct       900
     ttcggcctcc gacagctcac cgacgtcacc gtcaaggcct tgtcccccgg catcaacgac       960
     ccgacgaccg ccatccatgc cctcggacat gccagcgcac tgctcaccga actggttggc      1020
     cgggacctcg gtccccgcgt actcgccgac gacgacggcc cgacccgggt gatcctgcag      1080
     cggcccggct tcgccgagct gctcgacctg gccgtggccc agccccgccg ttatggcgcc      1140
     ggtgatccgg cggtgctcga ccgcctcttc cagctgctgc gcgaggtcgc ctggctggtc      1200
     acggatccca tcgagcaacg cagcattgcc gagcagctcg cccggctgcg agcgaccacc      1260
     gaagcgcaat ccttcgatgt ggctgaacag aagatgctca aacgcaccgc cgacgaggtc      1320
     atcccggcac tcgggggtcg ctggcgccat cgatcctga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page