(data stored in ACNUC30630 zone)

EMBL: CP001737.PE381

CP001737.PE381       Location/Qualifiers
FT   CDS_pept        427487..427753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76819"
FT                   /db_xref="UniProtKB/TrEMBL:C8X648"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76819.1"
FT                   /translation="MTVANHTEGALDREVRDLLANVACSVPADVVKDVVSAVRQDLEGQ
FT                   VPAEAFPEFLHRSVVQRLLTRAVAGGRCAPPADPADSLSGVAQ"
     atgacagtgg cgaaccacac cgagggcgcg ctggaccgtg aagtgcgcga cctgctggca        60
     aacgtggcct gctcggttcc ggcagatgtg gtcaaggacg tggtgtccgc ggtgcgccaa       120
     gatctggaag gtcaggtccc ggcggaggcg ttcccggagt tcttgcaccg gtccgtggtc       180
     cagcggttgc tcacccgggc cgtggccggc ggccgctgcg cgccgccggc ggatcccgcc       240
     gacagtcttt cgggcgtcgc gcagtga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page