(data stored in ACNUC30630 zone)

EMBL: CP001737.PE385

CP001737.PE385       Location/Qualifiers
FT   CDS_pept        complement(430215..430508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76823"
FT                   /db_xref="UniProtKB/TrEMBL:C8X652"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76823.1"
FT                   /translation="MSLTLDNACEVLDHCVADTPAGGFTRTSHHAGHLAPGDLWRPDRR
FT                   EGPHTITELRRSADQVTLVDQTGTSYRYRTDAILPTAVADPLVPRPRDMVYP"
     atgagcctca ccctcgacaa cgcgtgcgag gttctggatc actgcgttgc ggacacccca        60
     gcgggcgggt tcacccgtac cagtcaccac gccggacatc tcgcaccggg cgacctgtgg       120
     cggcccgacc ggcgcgaggg gccgcacacg atcaccgaac tgcgccggag cgccgaccag       180
     gtcaccctgg tggatcagac cggtacgtcc taccgatacc gcaccgacgc gatcctgccg       240
     accgcggtcg ccgatccgtt ggtcccgcgg ccaagggaca tggtctaccc ctga             294
//

If you have problems or comments...

PBIL Back to PBIL home page