(data stored in ACNUC30630 zone)

EMBL: CP001737.PE388

CP001737.PE388       Location/Qualifiers
FT   CDS_pept        complement(435147..436628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0403"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: vvy:VV2044 sodium/alanine
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76826"
FT                   /db_xref="GOA:C8X655"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:C8X655"
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /protein_id="ACV76826.1"
FT                   /translation="MATAFVAAEETEPSGIDAAVNDAVGPIATWIEGIVFYRFEFFGVG
FT                   VPVIVLWLITGAVFFTIFLGFKNIVGFKHAIDLVRGRYSHPEDAGEVSHFQALATAVSG
FT                   TVGLGNIAGVAVAISLGGPGATFWMIVAGFFGMSLKMAECTLGVKYRKEHADGSVSGGP
FT                   MYYLRDGIAKLGKPRLGKVMAIVFAVCCVGGSLGGGNMFQSNQATALIVEVFGGEDYKW
FT                   AFGLVFAILVALVIIGGIKSIARVTDKIVPFMAVLYITAALVVIFANVSMIPAAFGQII
FT                   SGAFNPEGVVGGVVGVLIVGFQRAAFSNEAGVGSASIAHSAVRTKEPATEGFVSLLEPF
FT                   IDTIVICTMTALVIVITGVWDDPNSSELGGVGLTTAAFQSVLPWFQFVLVVAVVLFAFS
FT                   TMIAWSYYGMKATGYLFGDSAKAENIFKAVFCVFTLIGATLSLGPVIGFSDSMIFLMSV
FT                   PNLIGLYLLARVLKKEINGYWERIQSGEIEMVDKH"
     atggccacgg cattcgtcgc tgcggaggaa accgagccgt ccggcatcga cgcggcggtc        60
     aacgacgccg ttggtccgat cgcgacctgg atcgaaggga tcgtgttcta ccgcttcgaa       120
     ttcttcggcg tcggcgttcc ggtcatcgtg ctctggctca tcaccggtgc ggtcttcttc       180
     acgatcttct tgggcttcaa gaacattgtt gggttcaagc acgccatcga tctggtccgc       240
     ggccggtact cccacccgga ggacgccggg gaggtgtccc acttccaggc cttggccacg       300
     gcggtctccg gcacggtggg cctggggaac atcgccgggg tcgcggtggc catcagcctc       360
     ggcggaccgg gtgcgacgtt ctggatgatc gtcgccgggt tcttcgggat gagcctgaag       420
     atggccgaat gcacccttgg ggtcaagtac cgcaaggagc atgcggacgg ctcggtgtcc       480
     ggcggcccga tgtactacct gcgcgacggc atcgcgaaac tgggtaagcc ccggctcggc       540
     aaggtgatgg ccatcgtctt cgccgtctgc tgcgtcggcg ggtctctcgg cggcggcaac       600
     atgttccagt cgaatcaggc caccgcgctg atcgtcgagg tcttcggcgg cgaggactac       660
     aaatgggcgt tcgggctggt cttcgcgatc ctggtggcgc tggtgatcat cggtggcatc       720
     aagtcgatcg ccagggtcac cgacaagatc gtgccgttca tggcggtgct gtacatcacc       780
     gcagcgctgg tcgtcatctt cgcgaacgtc tcgatgattc cggccgcgtt cggtcagatc       840
     atcagcggcg cgttcaaccc ggagggggtc gttggcgggg tcgtcggcgt tctcatcgtg       900
     ggattccagc gggccgcatt ctccaacgag gccggcgtcg ggtcggcgtc gatcgcgcac       960
     tcggcggtcc ggacgaagga acctgccacc gagggtttcg tgtccctgct ggagccgttc      1020
     atcgacacca tcgtcatctg caccatgacg gccctggtca tcgtcatcac cggtgtctgg      1080
     gacgatccca attcctcgga gctcggcggg gtcgggttga caacagccgc cttccagtcg      1140
     gtactgccat ggttccagtt tgtcctggtg gtcgcggtcg tgctgttcgc gttctccacc      1200
     atgatcgcct ggtcgtacta cggcatgaag gccaccggct acctgttcgg cgacagcgcc      1260
     aaagcggaga acatcttcaa ggccgtcttc tgcgtcttca ccctgatcgg cgcaacgctg      1320
     tcactcggtc cggtcatcgg gttctccgac tcgatgatct tcctgatgtc ggtccccaac      1380
     ctcatcggcc tgtacctgct cgcccgggtg ctcaagaagg agatcaacgg gtactgggaa      1440
     cgaatccaat ccggcgagat cgaaatggtc gacaagcact ga                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page