(data stored in ACNUC30630 zone)

EMBL: CP001737.PE39

CP001737.PE39        Location/Qualifiers
FT   CDS_pept        complement(44734..46053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0039"
FT                   /product="formiminoglutamate deiminase"
FT                   /note="TIGRFAM: formiminoglutamate deiminase; PFAM:
FT                   amidohydrolase; Amidohydrolase 3; KEGG: mxa:MXAN_1010
FT                   N-formimino-L-glutamate deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76477"
FT                   /db_xref="GOA:C8XHY6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010252"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHY6"
FT                   /inference="protein motif:TFAM:TIGR02022"
FT                   /protein_id="ACV76477.1"
FT                   /translation="MSPAAYFAGHALLPDGPAAGVTFEVAAGRFTAIRTGSRPPAGATR
FT                   LSGVVLPGLANAHSHAFHRALRGRTHRGGGTFWTWREGMYRVAAALDPDSYLALAQATY
FT                   AEMALAGITTVGEFHYLHHAPGGRRYADPNAMGAALIQAAAEAGIRLTLLDTCYLAGGL
FT                   GPPGHLELGPEQLRFTDGDADGWAARVARLADAESVRIGAAVHSVRAVPRAALPVVAAA
FT                   AHGRPLHVHLSEQPAENQAALAFYGRTPTELLDEAGVLGPLTSAVHATHLTASDIAALG
FT                   RTGTTCCLCPTTERDLADGIGPARALLDAGAPLSLGSDQHAVIDLIEEARALEMHERLA
FT                   TLHRGRFSPEQLLTAATRHDSLGWTDAGSLAVGGRADLVAVRTDTARTAGADPAQILLA
FT                   ATAADVDTVVVDGQPVVTGGRHRLGDVGALLGAAIEPLWR"
     gtgagcccgg ccgcctactt cgccggccac gcgctgctgc cggacggccc ggccgccggc        60
     gtgacgttcg aggtggccgc gggtcggttc accgcgatcc ggaccggcag ccgcccaccg       120
     gccggcgcca cccggctgtc cggcgtggtc ctgcccggcc tggccaacgc gcacagccac       180
     gccttccacc gggcgctccg cggtcgcacc caccgcggcg gcggcacgtt ctggacgtgg       240
     cgggagggta tgtaccgggt cgccgcggcc ctggatcccg attcctacct ggccctggcc       300
     caggccacct acgccgagat ggccctggcc gggatcacca ccgtgggcga gttccactac       360
     ctgcaccacg cccccggcgg ccgccggtac gccgacccga acgcgatggg cgcggcgttg       420
     atccaggccg ccgcggaggc cggaatccgg ctgaccctgc tcgacacctg ttacctggcc       480
     ggcggtctgg ggcccccggg gcacctggag ctagggccgg agcagctgcg gttcaccgac       540
     ggcgacgccg acgggtgggc cgcccgggtg gcccggctgg ccgacgccga gtcggtccgg       600
     atcggcgcgg cggtgcactc ggtgcgggcc gtgccgcggg cggcgctgcc ggtggtggcc       660
     gcggccgcac acggacggcc gctgcacgtg cacctgtccg agcagccggc cgagaaccag       720
     gccgccctgg cgttctacgg ccgcacaccg accgagttgc tcgacgaggc cggggttctc       780
     ggcccactga cctcggcggt gcacgccacc cacctgacgg cgtccgacat cgccgcgctc       840
     ggccggaccg ggaccacctg ttgcctgtgc ccgaccaccg aacgggacct ggccgacggg       900
     atcggcccgg cccgcgccct gctcgatgcc ggcgcaccgc tcagtctcgg gtcggaccag       960
     cacgcggtga tcgacctgat cgaggaggcc cgcgcgctgg agatgcacga gcggctggcc      1020
     acccttcatc gcggccggtt cagtccggag cagttgctga ccgcggccac tcgccacgac      1080
     agcctgggct ggaccgacgc cggaagcctg gccgtcggcg ggcgggccga cctggtcgcc      1140
     gtccggaccg acaccgcccg cactgccggc gccgaccccg cgcagatcct gctggccgcg      1200
     accgccgccg acgtggacac cgtggtggtg gacggacaac cggtggtgac cggcggccgg      1260
     catcggctcg gcgatgtcgg cgcgctgctg ggcgccgcca tcgagcccct ctggcggtga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page