(data stored in ACNUC30630 zone)

EMBL: CP001737.PE390

CP001737.PE390       Location/Qualifiers
FT   CDS_pept        complement(437222..438535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0405"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="TIGRFAM: Na+/H+ antiporter NhaA; PFAM: Na+/H+
FT                   antiporter NhaA; KEGG: ret:RHE_CH00589 Na+/H+ antiporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76828"
FT                   /db_xref="GOA:C8X657"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:C8X657"
FT                   /inference="protein motif:TFAM:TIGR00773"
FT                   /protein_id="ACV76828.1"
FT                   /translation="MVGSPRTLFSPGTWAEDGRVAHILRKETVGGGLLLLATVVALVWA
FT                   NTAVSESYFQLLDTELGPAALHLNLTVGEWAGDGLLAIFFFVAGLELKREFVAGDLRDP
FT                   HRAVVPVAAAFGGMIVPALLYLVIAGGTGPKGWAIPTATDIAFALAVLAVISTHLPAAL
FT                   RTFLLTLAVVDDLLAITIIAVFYTDDLQPVWLLLALAPLALFTVLVQRRISSWWLLLPL
FT                   AFVTWSLVHASGVHATVAGVLLGFAVPVRARKVRGKDDDRPGMAEHFEHLWRPISAGIA
FT                   VPVFALFSAGVAIGGWSGLRSALTDPIAVGIIAGLVLGKPVGILTATYLTSRLTRRPLQ
FT                   RGLTWPDLTGVALLGGVGFTVSLLIGELAFGGSSAADDHVKIAVLAGSVTAAVLAAVLL
FT                   RMRNRRYRAICEEEERDDDHDGIPDIYQMRTPLDPPES"
     atggtcggct ccccccgcac gttgttctca cccgggacgt gggccgagga cggtcgtgtc        60
     gcccatatcc tccgcaagga aacagtcggc ggtggcctgt tactcctggc aacagtggtg       120
     gccctggtct gggccaacac agcggtttcg gaaagctact tccaactgtt ggataccgag       180
     ctcggacctg ctgcactgca tctgaacctc acggtcggcg agtgggccgg cgacgggttg       240
     ctggcgatct tcttcttcgt cgccgggttg gaactcaaac gcgagttcgt ggccggtgac       300
     cttcgggacc cgcaccgcgc cgtggtaccg gtggccgccg cattcggcgg gatgatcgtc       360
     cccgccctgc tgtatctggt gatcgccggc ggaaccggcc ctaaggggtg ggcgatcccg       420
     accgccacgg acattgcctt cgcgttggct gtgctggcgg tcatctccac ccatttgccg       480
     gcggcgttgc gaaccttcct gctcaccctg gccgttgtcg acgacctgct ggccatcacg       540
     atcatcgccg tgttctatac cgacgacctc caaccggtgt ggctgctgct cgcgctggcg       600
     ccgttggccc tgttcacggt cctggtgcag agaagaatca gttcctggtg gctgctgctg       660
     ccgctggcgt tcgtcacctg gtcgttggtg cacgcgtcgg gggtgcacgc caccgtcgcc       720
     ggggtgctgc tcgggttcgc ggtcccggtg cgcgcccgga aggtcagagg caaggacgat       780
     gaccgaccgg ggatggcgga gcacttcgag catctctggc ggcccatttc cgccgggatc       840
     gcggtgccgg tgttcgcctt gttctcggcc ggcgtcgcga tcggtggttg gtccggtttg       900
     cggtcagcgt tgaccgaccc gatcgcggtc ggcatcatcg ccggtctggt cctggggaaa       960
     ccggtcggca tcctgaccgc tacctatctg acgtcgagac tcacccgccg tccgttgcag      1020
     agggggctga cctggcccga tctgaccggg gtggccctgc tcggcggtgt cggcttcacc      1080
     gtgtccctgt tgatcgggga actcgccttc ggcggtagct ccgccgccga cgatcacgtc      1140
     aagatcgccg tcctggccgg atcggtgacg gccgctgtgc tggcggcggt gctcctgcgg      1200
     atgcggaacc gccgctaccg cgccatctgc gaggaggagg aacgagacga cgaccacgac      1260
     ggaatccccg acatctatca gatgagaacg cctttggacc cacccgaatc gtga            1314
//

If you have problems or comments...

PBIL Back to PBIL home page