(data stored in ACNUC30630 zone)

EMBL: CP001737.PE392

CP001737.PE392       Location/Qualifiers
FT   CDS_pept        439641..440807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0408"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: net:Neut_0318
FT                   sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76830"
FT                   /db_xref="GOA:C8X659"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C8X659"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACV76830.1"
FT                   /translation="MHVSAAFLVEFGILLLILGAVSAVAGKLGLSAVPLFLIAGLFVGP
FT                   GGLLPVPAAAPFLEAGAVIGVVLLLLSLGLEFSADEFTQALRRHTPSGVVDLVLNAVPG
FT                   VVAGLLLGLPVAGVVALGGITWVSSSGIVSRTLSDLGRLGYRETPAVLSVLVLEDVAMA
FT                   VYLPMLGILLAGTAFLAGLAGVLVAVVALIGVLMLSRWSGPVIGWLITHDSDEQVLLRL
FT                   LALTLLVAGAAEYMGISAAVGAFLVGLAVPAEAAESVRRVIGPLRDLFAAAFFLSFGYA
FT                   IDPRDMPPALVVAALLAVVTAVTKVITGWFAARRDGVGARGRRRAGTALIARGEFSMVI
FT                   AGLAVAAGVTEIGPLAATYVLLLAVGGSLLTRLSGQGRDRLAHPHRQA"
     gtgcatgtca gcgcggcgtt cctggtcgag ttcggcatcc tgttgctcat cctgggtgcg        60
     gtcagcgctg ttgccgggaa gctgggtctg tccgcggtgc cgttgttcct gatcgccgga       120
     ctattcgtcg gccccggcgg cctgctgccg gttcctgccg cggccccgtt cctggaggcg       180
     ggggcggtga tcggcgtggt gctgctcctg ctgtccctcg gtttggagtt ctccgcggac       240
     gagttcactc aggcgctgcg gcgccacacg cccagtggcg tggtcgatct ggtgctgaac       300
     gcggttcccg gggtggtcgc cggtctgctg ctcggacttc ctgtcgccgg cgtggtcgcg       360
     ctcggtggga tcacctgggt gtcctcatcc ggcatcgtct cgcgcaccct gtcagacctg       420
     ggtcgactgg gctaccggga aacgcccgcg gtgctctcgg ttctggtcct cgaggatgtc       480
     gcgatggcgg tctatctgcc catgctgggc atcctgctgg ccggcaccgc cttcctggcc       540
     ggactggcgg gagtcctggt ggcggtggtc gccctgatcg gcgtgctcat gctttcccgc       600
     tggtcgggac ccgtgatcgg gtggctgatc acgcacgact cggacgaaca ggtgctgctg       660
     cggctgctcg cgttgacctt gctggtcgcc ggcgcggccg agtacatggg catctctgca       720
     gcggtcggcg cgttcctggt tggcctggcc gtgccggcgg aggctgccga gtccgtccgc       780
     cgggtgatcg gcccgctccg ggatctgttc gccgccgcat tcttcctctc cttcggctac       840
     gcgatcgacc cgcgggacat gccgccggcc ctggtcgtgg cggccctgct cgcggtggtc       900
     accgcggtca ccaaggtgat caccggttgg ttcgcggccc gccgcgacgg tgtcggtgcc       960
     cgtggtcggc ggcgggccgg gacggcgctg atcgcgcggg gtgaattctc gatggtcatc      1020
     gccggtctgg cggtggccgc cggcgtgacc gagatcgggc cgctggccgc gacctacgtg      1080
     ttgctgctcg ccgtcggagg ttcgctgctc acccgtctgt ccggacaggg cagggacaga      1140
     ctcgcgcatc cgcaccgcca ggcttga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page