(data stored in ACNUC30630 zone)

EMBL: CP001737.PE398

CP001737.PE398       Location/Qualifiers
FT   CDS_pept        complement(446290..447654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0414"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: gbm:Gbem_1853
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76836"
FT                   /db_xref="GOA:C8X665"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8X665"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACV76836.1"
FT                   /translation="MTVPAPTTRTTPVNDDRRPGCWALTRVVLASLAIGATIALVLTMA
FT                   VFPGAAEGVVTGSLLFGFGLGWAALAVISERKTSQPQRWARVPAAAMMATGAGLMVCAP
FT                   QDAALTALNWVWPPLMLALVAWMYARSRRAMPGRARWLLTPVFVVLTLASVGAGVQNVT
FT                   SVGFAQDHPAPGQSYSVGDHRLHIQCHGAGGPTAVLFNGLGEFSGSWARIDDQVSATTR
FT                   VCAYDRAGQGWSDDVDRPQDGIAAAADLHALLAAAGEHGPYVLVGHSIGGPYALTYAAQ
FT                   YPQDVAGMVLLDSASPRQFTEMPAYPTQYALMKRGLALLPTLARIGLGPASTPTSHLPG
FT                   ADADTVDAMGSTVRAKRNGRDELSIIPDLFEQAQTLTTLGDRPLAVVTASENLSTEGWP
FT                   AEQDRLATLSSDSIHSVVNSSHAGVVEDGPGSDASVAAITAVVHAVGSGSPVTTA"
     atgaccgtac ccgcacccac cacccgcacg acgcccgtga acgacgatcg acgcccgggc        60
     tgctgggccc tcacccgcgt cgtcctcgca tccctggcga tcggggcgac catcgctctg       120
     gtgctgacca tggcggtctt cccgggtgcc gccgaggggg tcgtcaccgg ctccctgctg       180
     ttcggcttcg gcctcggctg ggccgcgctg gccgtcatct ccgagcggaa gacgagccaa       240
     cctcagcgct gggcgcgagt cccggccgcc gccatgatgg caaccggggc cggcctgatg       300
     gtctgcgctc cccaagatgc cgccctcacg gccctcaact gggtgtggcc gccactcatg       360
     ctcgccctcg tcgcctggat gtacgcccgg tcccgccgcg ccatgcccgg ccgggcccgg       420
     tggctgctga cgccggtgtt cgtcgtcctt actctcgcct ccgtcggcgc aggagtccag       480
     aacgtcactt ccgttgggtt cgcccaggac caccccgccc ccggccagag ctactccgtg       540
     ggcgaccacc gactgcacat ccagtgccac ggggcgggag gacccaccgc ggtgctgttc       600
     aacggcctcg gcgagttctc cggctcctgg gcccggatcg acgaccaggt cagcgcgacc       660
     acaagggtgt gtgcctacga ccgcgccggc cagggctgga gcgacgacgt cgaccgcccc       720
     caggacggta tcgccgccgc cgcagacctc cacgccctgc tggccgccgc cggcgagcac       780
     ggtccctacg tcctcgtcgg ccactccatc ggcggcccgt atgccctcac ctacgccgcg       840
     cagtacccac aggacgtggc cggcatggtg ctcctggaca gcgccagccc caggcagttc       900
     accgagatgc ccgcctaccc cacgcagtac gcgctgatga agcgtgggct cgccctcctg       960
     cccacactgg cccggatcgg gctgggaccg gccagcaccc ccacctcgca cctgcccggc      1020
     gcggacgcag acacagtcga cgcgatgggc tccaccgtcc gggccaagcg caacggccgg      1080
     gacgagctct cgatcatccc cgacctcttc gagcaggctc agacgcttac caccctcggc      1140
     gaccgcccac tggccgtcgt cacggcctcc gagaacctga gcacggaggg ctggcccgca      1200
     gagcaagacc ggctcgcgac cctctcgagc gacagcatcc acagcgtcgt caactcctcc      1260
     cacgccggcg ttgtggaaga cgggcccggc tccgacgcct ccgtggcggc catcaccgcc      1320
     gtcgtccacg ccgtcggctc cggttcgccg gtgaccactg cctga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page