(data stored in ACNUC30630 zone)

EMBL: CP001737.PE401

CP001737.PE401       Location/Qualifiers
FT   CDS_pept        451284..452255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0417"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   scl:sce1535 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76839"
FT                   /db_xref="GOA:C8X668"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X668"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACV76839.1"
FT                   /translation="MRAVLQDRYGTAEVLRLGSVPRPVIGDHDVLVEVRAAGLDRGTEH
FT                   LMMGKPYAVRLATGLRRPRNPVPGRDVAGTVVEIGAAVTRFAVGDEVYGVAPGSFAEYV
FT                   AAPESRLARKPASLTFTQAAVVPVSAATALRALVDVGRVQAGQSVLVVGASGGVGSYAV
FT                   QIAKALGAEVTGVCSAPKADLVASLGADHVIDYTRDDFADGSRHYDIVLDIAGNPSLNR
FT                   LRRALRPRGTAVFVGGEDAGALTGMGRQLRGALLSIFLKQRLALLVTKERGSDYDRLTE
FT                   MIEAGQLAASIDRIYPLEDAPHAVRQLQAGHVRGKVAITMER"
     atgcgcgcag tcctgcaaga tcgctacggg acagccgagg tccttcggct cggcagcgtg        60
     ccccgtccgg tgatcggcga ccacgacgtg ctcgtcgagg tccgcgcggc cggactggat       120
     cgcggcacag aacacctcat gatgggcaag ccgtacgccg tgcggctcgc gacgggcctg       180
     cgccgcccca ggaaccccgt tcccggccgg gacgtcgccg gtaccgtcgt cgagatcggc       240
     gcggccgtca cacggttcgc cgtcggggac gaggtctacg gggtcgctcc ggggtcgttc       300
     gccgagtacg tcgccgcccc cgagtcccgg ctcgcccgca agccggccag tctcacgttc       360
     acccaagcgg ccgttgtccc ggtctcggcc gccacggcgc tgcgggcact cgtcgacgtc       420
     ggccgcgtcc aggccggcca gtccgtcctc gtggtcggtg cctccggtgg cgtcggaagc       480
     tacgccgttc agatcgcgaa ggccctcggg gccgaggtca ccggcgtctg cagcgccccg       540
     aaggcggacc tggtcgcgtc gctcggagcg gaccacgtca tcgactacac ccgcgacgac       600
     ttcgcagatg gctcccgcca ctacgacatc gtcctcgaca tcgcgggcaa cccctcactc       660
     aaccggctcc gtcgggcgct ccgaccccga ggaaccgccg tcttcgtcgg cggtgaggac       720
     gccggcgcgc tgaccggcat gggcaggcag ctgcgcggcg cgctgctctc catcttcctc       780
     aagcagcgcc tcgccctgct ggtcaccaag gagcgcggca gcgactacga ccgcctcacc       840
     gagatgatcg aggcgggcca gctggccgcg agcatcgacc gcatctatcc gctcgaggac       900
     gcaccgcacg ccgtacggca gcttcaggcc ggacatgtcc ggggcaaggt cgccatcacc       960
     atggaacgat ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page