(data stored in ACNUC30630 zone)

EMBL: CP001737.PE416

CP001737.PE416       Location/Qualifiers
FT   CDS_pept        470493..471419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76854"
FT                   /db_xref="UniProtKB/TrEMBL:C8X683"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76854.1"
FT                   /translation="MALHSVRGSDGFGADEGVDVDADAGFFEMSPAGAEQVTLQIRSMM
FT                   ERAWEYIAIAYQGRAHIALGYETWDEYVDDRLGDLRLTVPRQERGAVVQSLSRAQMSLR
FT                   AIAKVLGVDVATVHRALGADDPAGAAGREGVDDASPIRGRDGKQYPRRCRPTAMAVTCS
FT                   ICGEVHEGDPDECPWDLFAQGLGPRPVRQDCRSGASVDCREREEVVEVAVTSDHPEEAG
FT                   ATSSPDSTIDEEVQAATIVDSVTRAVFLVGELATLPELIEEIELVGVSAEPAELAAGIR
FT                   ELIEHLRVQAAAIVTLADRLERIAPQR"
     atggcgctgc actcggtgcg tgggtcggac ggcttcggcg ccgatgaggg cgtcgatgtc        60
     gatgcggatg cgggcttctt cgagatgtcg ccggccggcg cggagcaggt cacgctgcag       120
     atccggtcga tgatggaacg ggcctgggag tacatcgcca tcgcctatca gggccgggcg       180
     cacatcgcgc tgggctacga gacgtgggat gagtacgtcg acgaccgcct gggcgatctg       240
     cggctgaccg ttccccggca ggagcggggt gcggtggtcc agtcgttgtc gcgtgcgcag       300
     atgtcgttgc gagcgatcgc gaaggtactg ggtgttgacg tggccacggt gcatcgggcg       360
     ttgggtgcgg acgacccagc tggcgccgcg gggcgggagg gcgtcgatga tgcctctcca       420
     atccgtggcc gtgatgggaa gcagtacccg cgccggtgcc gaccaacggc catggcagtg       480
     acttgttcga tctgcggcga ggtccatgag ggggatcccg acgagtgccc gtgggacctg       540
     ttcgcccagg ggcttggccc gcggccggtg cgtcaggatt gccgatctgg tgcgtcggtg       600
     gattgccggg aacgcgagga agtggtggag gtcgcggtga cgtcggatca ccctgaggaa       660
     gccggcgcga cttcgtctcc ggattcaacc atcgacgaag aggtgcaggc tgcgaccatc       720
     gtcgattctg tgacccgggc ggtcttcctc gtcggcgagc tggccacgct gcccgaactg       780
     atcgaggaga tcgagctcgt cggtgtgtca gcggagccgg ctgagcttgc ggccggcatc       840
     cgcgaactga tcgagcatct gcgggtccag gccgccgcga tcgtgacatt ggctgatcgg       900
     ctcgaacgga tcgctccgca gcggtga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page