(data stored in ACNUC30630 zone)

EMBL: CP001737.PE420

CP001737.PE420       Location/Qualifiers
FT   CDS_pept        475756..477126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0438"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   sun:SUN_1976 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76858"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C8X687"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACV76858.1"
FT                   /translation="MTKSCTLDRLSVRADEDSVVSDAGLLVAATLAQRLDLAGLLREHV
FT                   TVPGSVGAHPDRKCLTVVHSLLAGGDCIDDVNALRAGSTSAVLGHRVAAPSTVGTFLRA
FT                   FGFGHARQLDVVTRRLLTRAVTAGAHPQFGRSVTVDIDSTLCETFGLAKDGAREVMRTG
FT                   RRGYHPLLAVISGTGDIAHARLRRGRSNDATAAPLFINETISRLRQAGATGQIVLRADS
FT                   GFYLHDVVAACRAADVRFSIGARMIGHLRGQIEAIPDEQWQPIEYFLPGAGVAEIPYTP
FT                   FAQDTHGRDRTDTVPLRLMVRRTPPTQAQVRNRGQDTDQAALFPVYDYHPIITDRDGDL
FT                   RDLEADHRRHAEVELTIRDLKHGMGLAHLPTKSFGGNAAWLILNTIAHNLTRWITRLGF
FT                   DQGHRMTKNIRRRVFNLAGRLVRTGRRTTLRLPSRWPWAHAIITAIKRLRDLPAATG"
     gtgacgaagt cttgcacact ggaccgcttg tccgtacgcg ctgacgagga cagtgtcgtg        60
     tccgatgccg ggttgctggt cgcggcaact ttggcccaac ggctggatct ggccggtttg       120
     ttgcgtgagc acgtcacggt gcccgggagc gtgggcgccc acccggaccg caagtgcctg       180
     accgtcgtcc attcgctgct ggccggcggt gactgcatcg atgacgtgaa cgctttgcgg       240
     gcgggctcga ccagcgcagt gctgggacac cgggtcgcgg cgccgtccac ggtcggcacg       300
     ttcctccgcg ctttcggctt cggacacgcc cgccaactgg acgtggtgac ccgccgcctg       360
     ctgacccgag ctgtgaccgc cggcgcacat ccacagttcg gtcggtcggt caccgtcgat       420
     atcgactcga ccctgtgtga gacgttcggg ctggccaagg acggtgcccg ggaagtcatg       480
     cggaccgggc gccgcggcta ccacccgctg ctggcagtga tctccgggac cggcgatatc       540
     gcgcatgccc ggctccggcg gggccgttcc aacgacgcca ccgcggcacc gctgttcatc       600
     aacgaaacga tctcccggct gcgtcaggcc ggcgccaccg ggcagatcgt gctgcgcgcc       660
     gactccggct tctatctgca cgacgtcgtc gcggcctgcc gggccgccga tgtgcggttc       720
     tcgatcggcg cccggatgat cgggcaccta cgaggacaga tcgaggcgat cccggacgag       780
     caatggcagc cgatcgagta cttcctgccc ggcgccgggg tcgccgagat cccgtacacc       840
     ccgttcgccc aggacaccca cggccgcgac cggaccgaca ccgtcccgct acgactgatg       900
     gtgcggcgca ccccacccac ccaggcccag gtccgcaacc gcggccagga caccgaccag       960
     gcagcgttgt tcccggtcta cgactaccac ccgatcatca ccgaccggga cggcgacctg      1020
     cgcgacctgg aggccgacca tcgccggcac gccgaggtcg agctcaccat ccgggacctc      1080
     aaacacggca tgggtctggc gcacttgccg accaaaagct tcggcgggaa cgccgcctgg      1140
     ctgatcttga acaccatcgc ccacaacctc acccgctgga tcacccgcct cggctttgac      1200
     caaggccacc ggatgaccaa gaacatccgc cgccgcgtgt tcaacctcgc cggccggctg      1260
     gtccgcaccg gccgacgcac caccctgcgg ctacccagtc gctggccctg ggcccacgcc      1320
     atcatcaccg ccatcaaacg gctccgcgac ctacccgcgg cgaccggata a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page