(data stored in ACNUC30630 zone)

EMBL: CP001737.PE423

CP001737.PE423       Location/Qualifiers
FT   CDS_pept        479165..479908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76861"
FT                   /db_xref="GOA:C8X690"
FT                   /db_xref="UniProtKB/TrEMBL:C8X690"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76861.1"
FT                   /translation="MNWQPQSGTEAITGWINQGVLFALVLAVAAVVVCAATWAVGSLAA
FT                   NGAVVARARTGVAVSLAAALLLGGGVTWVHWTDTQAAAFAGDPKDYGIEDAPQTPAQWE
FT                   VLDLSEWWTGNINTIRARDGLPPLATDGGLAERARSCASSRAGQGGDCPRNYFSCRQDT
FT                   GMVYAAWDYGPGDLDKLNQDLAEAFIRSPNPWGGDDTHRTLDPSTDMRSAWVALRDNAN
FT                   KKAVVVALLENRAGLAEWNECGTFQ"
     atgaactggc aaccacaatc gggcaccgag gcgatcaccg gctggatcaa ccagggcgtg        60
     ctgttcgccc tggtcctggc ggtcgccgcg gtggtcgtgt gtgcagcgac gtgggcggtc       120
     gggtcgctgg ctgcgaacgg cgcggtcgtg gcgagggcgc ggaccggtgt ggcggtgagc       180
     ctggccgcgg cgctgctgct cggcggcggc gtcacctggg tgcactggac tgacacccaa       240
     gcggccgcgt tcgccggcga ccccaaggac tacggcatcg aggatgcccc gcagacaccg       300
     gcgcagtggg aggtccttga cctgtcggag tggtggaccg ggaacatcaa cacgatccgg       360
     gccagggatg gcctgccgcc gctggcgacg gatggtgggt tggcggagcg ggcgcggtcg       420
     tgcgcgagca gccgcgccgg gcagggcggt gattgccccc gcaactactt ctcctgccgc       480
     caggacaccg ggatggtgta cgcggcgtgg gactacggcc cgggggatct ggacaagctg       540
     aaccaggacc tggccgaggc gttcatccgc agcccgaacc cgtggggcgg cgacgacacc       600
     caccgcacgt tggatccatc gacggacatg cggtcggcgt gggtggcgtt gcgggacaac       660
     gccaacaaga aggccgtggt cgtcgccctg ctggaaaaca gggccgggct cgcggagtgg       720
     aacgaatgcg gcaccttcca atga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page